| Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001338930.1 | Gene: | NTM / 50863 | HGNCID: | 17941 | Length: | 367 | Species: | Homo sapiens |
| Alignment Length: | 286 | Identity: | 60/286 - (20%) |
|---|---|---|---|
| Similarity: | 116/286 - (40%) | Gaps: | 53/286 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 FVNESFIIFCQTVQKDIDTKW-RDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
Fly 124 VNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLY- 187
Fly 188 NGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHW--F 250
Fly 251 FNET----LPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKN 311
Fly 312 ASQ--FGDYKCKVANPLGMLERVIKL 335 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 14/59 (24%) |
| IG_like | 256..336 | CDD:214653 | 22/82 (27%) | ||
| IGc2 | 263..327 | CDD:197706 | 16/65 (25%) | ||
| FN3 | 341..445 | CDD:238020 | |||
| NTM | NP_001338930.1 | Ig | 44..132 | CDD:416386 | 18/88 (20%) |
| Ig strand A' | 44..49 | CDD:409353 | |||
| Ig strand B | 51..59 | CDD:409353 | |||
| CDR1 | 59..63 | CDD:409353 | |||
| FR2 | 64..70 | CDD:409353 | 0/1 (0%) | ||
| Ig strand C | 64..70 | CDD:409353 | 0/1 (0%) | ||
| CDR2 | 71..83 | CDD:409353 | 3/17 (18%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 84..118 | CDD:409353 | 11/43 (26%) | ||
| Ig strand D | 87..94 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 97..103 | CDD:409353 | 2/15 (13%) | ||
| Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 123..132 | CDD:409353 | 1/17 (6%) | ||
| FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
| Ig_3 | 136..205 | CDD:404760 | 16/81 (20%) | ||
| Ig strand A' | 142..147 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 153..160 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 166..171 | CDD:409353 | 2/4 (50%) | ||
| Ig strand D | 177..180 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 184..190 | CDD:409353 | 2/11 (18%) | ||
| Ig strand F | 197..204 | CDD:409353 | 4/13 (31%) | ||
| Ig strand G | 211..219 | CDD:409353 | 1/7 (14%) | ||
| Ig_3 | 222..299 | CDD:404760 | 18/81 (22%) | ||
| putative Ig strand A | 223..229 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 239..243 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 252..256 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 278..282 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 292..297 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165143451 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.700 | |||||