DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and dpr6

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:343 Identity:66/343 - (19%)
Similarity:116/343 - (33%) Gaps:115/343 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IALCSLLLLLLSQNAAILGQLDSTSSGGSG----------------TGGAPPDRPPTPPLS---- 49
            :.||...||||    .::...|.|:.|..|                |.|......||.|.:    
  Fly     7 LPLCVAWLLLL----VVIVMSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTH 67

  Fly    50 -------LQPSTP-SITHFVNESFIIFCQTVQKDIDTK---W---RDPRGQTRENTKGRVHIEKK 100
                   ..|||| ::|..:.:|..:.|:.  :::..|   |   ||            :||  .
  Fly    68 PKWMEPYFDPSTPRNVTALMGKSAYLSCRV--RNLANKTVSWIRHRD------------IHI--L 116

  Fly   101 TTGLLALV----FEHIALEDRGNWTCEVN-------GNRNGNRNVNVEREFLASFELLVNQKISF 154
            |.|.....    |:....:|..:||.::.       |......:....|.:.....::|......
  Fly   117 TVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATIL 181

  Fly   155 GKTEQVQSVREGRDAMVNCFVEGMPAPE--VSWLYNGEYIN--------TVNSTKHNRLSNGLYI 209
            |..:  ..|.:|....:.|.|:..|.|.  :.|.::.|.||        :|.:.|.:..::.|.|
  Fly   182 GGPD--LHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLI 244

  Fly   210 RNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMG 274
            :|...||:|:|:|..       |::|..::.:.:                      :|:.....|
  Fly   245 QNADLADSGKYSCAP-------SNADVASVRVHV----------------------LNVRAIISG 280

  Fly   275 EPPPS---------FTWL 283
            |.|.:         :.||
  Fly   281 EHPEAMQTGSSGCQYNWL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/68 (28%)
IG_like 256..336 CDD:214653 6/37 (16%)
IGc2 263..327 CDD:197706 6/30 (20%)
FN3 341..445 CDD:238020
dpr6NP_001287018.1 V-set 79..174 CDD:284989 19/110 (17%)
IG_like 80..175 CDD:214653 18/110 (16%)
IG_like 184..271 CDD:214653 22/95 (23%)
IGc2 191..262 CDD:197706 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.