DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and OPCML

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:320 Identity:66/320 - (20%)
Similarity:110/320 - (34%) Gaps:99/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
            ::|.|.|::..      :.||. ||          ||.|...|....:::.:::.:.|.|.:||.
Human    68 WLNRSTILYAG------NDKWSIDP----------RVIILVNTPTQYSIMIQNVDVYDEGPYTCS 116

  Fly   124 VNGNRNGNRN-----VNVEREFL-ASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPE 182
            |..:.:...:     |.|..:.: .|.::.||               ||....:.|...|.|.|.
Human   117 VQTDNHPKTSRVHLIVQVPPQIMNISSDITVN---------------EGSSVTLLCLAIGRPEPT 166

  Fly   183 VSWLYNGEYINTVNSTKHNRLSNG---------LYIRNVSQADAGEYTCRAMRITPTFSDSDQIT 238
            |:|             :|..:..|         |.|.::.:..:|||.|.|:.   ..:..|...
Human   167 VTW-------------RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALN---DVAAPDVRK 215

  Fly   239 ILLRIQHKPHWFFNETLPVQYAYVGGAVN----------LSCDAMGEPPPSFTWLHNN----KGI 289
            :.:.:.:.|             |:..|.|          |||:|...|...|.|....    .|:
Human   216 VKITVNYPP-------------YISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGL 267

  Fly   290 VGFNHRIFVADYGATLQLQMKNASQ--FGDYKCKVANPLGMLERVI---KLRPGPKPLGP 344
            .|..    :.:.|....|...|.|:  :|:|.|...|.||.....|   ::.|.....||
Human   268 DGMR----IENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAVAGP 323

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 11/52 (21%)
Ig strand E 105..109 CDD:409353 0/3 (0%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 18/94 (19%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 2/12 (17%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 23/98 (23%)
Ig strand B 266..270 CDD:409353 2/13 (15%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 2/4 (50%)
OPCMLNP_001306032.1 Ig 44..132 CDD:472250 16/79 (20%)
Ig strand B 53..57 CDD:409353