DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and opcml

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:304 Identity:68/304 - (22%)
Similarity:111/304 - (36%) Gaps:82/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
            ::|.:.|:|..      :.||. ||          ||.:........::...::.|.|.|.:.|.
Zfish    65 WLNRTTILFTG------NEKWSLDP----------RVVLLNTAVNEYSIKILNVNLYDEGPYVCS 113

  Fly   124 VNGNRNGN------------RNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVE 176
            :..|:...            |.|||..:.                     ||.||.:..:.|...
Zfish   114 ILTNKKPESTKVHLIVQVPARIVNVSTDV---------------------SVNEGSNVSLMCLAI 157

  Fly   177 GMPAPEVSWLYNGEYINTVNSTKHNRL-SNGLYIR--NVSQADAGEYTCRAMRITPT-FSDSDQI 237
            |.|.|.:.|.:        .|:|.||: :.|.|:.  .:::..:|.|.|    ||.. .|..|..
Zfish   158 GRPEPSILWKF--------RSSKGNRIVTEGEYVEMTGITKDMSGSYDC----ITSNDISPPDVR 210

  Fly   238 TILLRIQHKPHWFFNETLPVQYAYVGGAVN----LSCDAMGEPPPSFTWLHNNKGIV-GFNHRIF 297
            |:.:.:.:.|       :..:....|.||.    |.|:|...|...|.|....:.|: ||| .:.
Zfish   211 TVQVTVNYPP-------VISRARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFN-GVK 267

  Fly   298 VADYGATLQLQMKNASQ--FGDYKCKVANPLGMLE-RVIKLRPG 338
            :.:.|....|...|.|:  :|:|.|...|.||:.. .:|...||
Zfish   268 IENKGKQSMLTFFNVSEEDYGNYTCVAINTLGITNASIILYGPG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/61 (26%)
IG_like 256..336 CDD:214653 24/87 (28%)
IGc2 263..327 CDD:197706 21/70 (30%)
FN3 341..445 CDD:238020
opcmlNP_001005580.1 Ig 41..129 CDD:299845 14/79 (18%)
IG_like 41..129 CDD:214653 14/79 (18%)
IG_like 139..216 CDD:214653 23/109 (21%)
IGc2 146..202 CDD:197706 18/67 (27%)
I-set 219..307 CDD:254352 24/95 (25%)
ig 223..307 CDD:278476 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576325
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.