DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and opcml

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:304 Identity:68/304 - (22%)
Similarity:111/304 - (36%) Gaps:82/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
            ::|.:.|:|..      :.||. ||          ||.:........::...::.|.|.|.:.|.
Zfish    65 WLNRTTILFTG------NEKWSLDP----------RVVLLNTAVNEYSIKILNVNLYDEGPYVCS 113

  Fly   124 VNGNRNGN------------RNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVE 176
            :..|:...            |.|||..:.                     ||.||.:..:.|...
Zfish   114 ILTNKKPESTKVHLIVQVPARIVNVSTDV---------------------SVNEGSNVSLMCLAI 157

  Fly   177 GMPAPEVSWLYNGEYINTVNSTKHNRL-SNGLYIR--NVSQADAGEYTCRAMRITPT-FSDSDQI 237
            |.|.|.:.|.:        .|:|.||: :.|.|:.  .:::..:|.|.|    ||.. .|..|..
Zfish   158 GRPEPSILWKF--------RSSKGNRIVTEGEYVEMTGITKDMSGSYDC----ITSNDISPPDVR 210

  Fly   238 TILLRIQHKPHWFFNETLPVQYAYVGGAVN----LSCDAMGEPPPSFTWLHNNKGIV-GFNHRIF 297
            |:.:.:.:.|       :..:....|.||.    |.|:|...|...|.|....:.|: ||| .:.
Zfish   211 TVQVTVNYPP-------VISRARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFN-GVK 267

  Fly   298 VADYGATLQLQMKNASQ--FGDYKCKVANPLGMLE-RVIKLRPG 338
            :.:.|....|...|.|:  :|:|.|...|.||:.. .:|...||
Zfish   268 IENKGKQSMLTFFNVSEEDYGNYTCVAINTLGITNASIILYGPG 311

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 9/52 (17%)
Ig strand E 105..109 CDD:409353 0/3 (0%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 22/89 (25%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 24/87 (28%)
Ig strand B 266..270 CDD:409353 2/7 (29%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020
opcmlNP_001005580.1 Ig 41..129 CDD:472250 14/79 (18%)
Ig strand B 50..54 CDD:409353