DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Ama

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:260 Identity:63/260 - (24%)
Similarity:94/260 - (36%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EKKTTGLLALVF--EHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFG-KTEQ 159
            |...||.....|  ::|.:.|.|.:.|:|                |.|....|.:|:|.. ||..
  Fly    99 EGPKTGSAIYTFRIQNIEVSDMGPYECQV----------------LVSATEKVTKKLSLQIKTPP 147

  Fly   160 VQS--------VREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRL--SNG-------L 207
            |.:        |.||::..:.|...|.|.|.:||           :.:||.:  :.|       |
  Fly   148 VIAENTPKSTLVTEGQNLELTCHANGFPKPTISW-----------AREHNAVMPAGGHLLAEPTL 201

  Fly   208 YIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVN----L 268
            .||:|.:.|.|.|.|.|..   .....|:..|.:.::.:|.      :.||...:...|:    |
  Fly   202 RIRSVHRMDRGGYYCIAQN---GEGQPDKRLIRVEVEFRPQ------IAVQRPKIAQMVSHSAEL 257

  Fly   269 SCDAMGEPPPSFTWLHNNKGIVGFNHRIF---VADYGAT---LQLQMKNASQFGDYKCKVANPLG 327
            .|...|.|.|:..|..|...:....|...   .:..|.|   |::.......||||.|...|.||
  Fly   258 ECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLG 322

  Fly   328  327
              Fly   323  322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/67 (28%)
IG_like 256..336 CDD:214653 22/82 (27%)
IGc2 263..327 CDD:197706 18/73 (25%)
FN3 341..445 CDD:238020
AmaNP_731114.2 I-set 33..143 CDD:254352 14/59 (24%)
Ig 37..127 CDD:299845 8/27 (30%)
IG_like 154..234 CDD:214653 23/93 (25%)
IGc2 161..223 CDD:197706 20/75 (27%)
I-set 254..330 CDD:254352 19/69 (28%)
IGc2 254..322 CDD:197706 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.