DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and dpr16

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:166 Identity:41/166 - (24%)
Similarity:66/166 - (39%) Gaps:49/166 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELL 147
            |.||.|.|:         ::....|..:::.|||.|.:.|:          :..|.:..|..:|.
  Fly   291 PGGQERGNS---------SSLSWTLQIKYVNLEDAGWYECQ----------LATEPKMSAKVQLF 336

  Fly   148 VNQKISFGKTEQV----QSVREGRDAMVNCFVEG-MPAPEVSWLYNGE----------------Y 191
            |...    :||.:    :.|:.|....::|.|.| :.||:..:.|.|:                |
  Fly   337 VITP----RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWY 397

  Fly   192 I----NTVNSTKHNRLSNG-LYIRNVSQADAGEYTC 222
            .    |...||:|||.:.| |.|..|.:..:|.|||
  Fly   398 TQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTC 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 23/80 (29%)
IG_like 256..336 CDD:214653
IGc2 263..327 CDD:197706
FN3 341..445 CDD:238020
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 14/64 (22%)
Ig <298..338 CDD:299845 10/58 (17%)
IG_like 352..447 CDD:214653 24/82 (29%)
Ig 358..439 CDD:143165 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.