DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and CG7166

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:481 Identity:109/481 - (22%)
Similarity:182/481 - (37%) Gaps:112/481 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLLLLLLSQNAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQPSTPSITH----FVNESFIIFC 69
            :|:|.|.|.:.:::|          |:...|.:.|||    ..|...|..|    .|.|:..:.|
  Fly    10 TLVLYLFSFSLSLIG----------GSFILPENDPPT----TAPKFLSRGHLYKVIVGETIELPC 60

  Fly    70 QTVQK--DIDTKWRDPRGQTRENTKGRVHIEK----KTTGLLALVFEHIALEDRGNWTCEVNGNR 128
            : ||.  .....||  :|.: ..|.|.:.|.:    |..|...|....:..:|.|::.|::....
  Fly    61 K-VQNLGSFVLLWR--KGSS-VLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQLGDQE 121

  Fly   129 NGNRNVNVEREFLASFELLVNQKI-SFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYI 192
            |        |:.:.:.|:||...: :.....|| :.|:|....:.|...|.|.|.:.|...    
  Fly   122 N--------RDQVHTVEILVPPTLRALPHNGQV-TARKGSTVTLECKASGNPVPTIFWFKK---- 173

  Fly   193 NTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMR-ITPTFSDSDQITILL--RIQHKPHWFFNET 254
            :..:...|...|:.|.:.||.:..||.|.|.|.. :....|...|:|||.  .|..:..|.    
  Fly   174 DVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWV---- 234

  Fly   255 LPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHR-IFVADYGATLQLQMKNASQFGDY 318
                :|..|..|.|.|...|:......|..|:..:...:.| ::..|...:|.::....:.||:|
  Fly   235 ----HASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNY 295

  Fly   319 KCKVANPLGMLERVIKL--RPGPKPLGPRRFQLKKLYTNGFELDIQTPRMS------NVS----- 370
            .|...|.||..::.|::  ||||                   .|..:|.:|      |::     
  Fly   296 SCVADNALGRTKKYIEVSGRPGP-------------------ADFISPALSGFLDHYNLTWTIES 341

  Fly   371 ----DEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFH--------GGKHF----IIPHLETN 419
                ||:::. ||...|::|  ....|.|       ..:|        .|.||    ::.:||.|
  Fly   342 IPPLDEIKLL-YRRLLMNET--YQHPGKW-------HEYHIKPTPIRTDGSHFLMSYLVKNLEHN 396

  Fly   420 TTYLMRAASRNLAGLSDWSPVKVFTT 445
            ..|.....::|..|.::.|.:..|.|
  Fly   397 AVYEAIVQAKNKYGWNEISDIHQFYT 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 15/58 (26%)
IG_like 256..336 CDD:214653 19/82 (23%)
IGc2 263..327 CDD:197706 15/64 (23%)
FN3 341..445 CDD:238020 24/130 (18%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 20/94 (21%)
Ig 56..116 CDD:143165 14/63 (22%)
IG_like 144..221 CDD:214653 21/81 (26%)
IGc2 151..209 CDD:197706 16/61 (26%)
IG_like 232..313 CDD:214653 20/88 (23%)
Ig 242..311 CDD:143165 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.