Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094842.1 | Gene: | IGLON5 / 402665 | HGNCID: | 34550 | Length: | 336 | Species: | Homo sapiens |
Alignment Length: | 306 | Identity: | 67/306 - (21%) |
---|---|---|---|
Similarity: | 114/306 - (37%) | Gaps: | 71/306 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 FVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEV 124
Fly 125 NGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNG 189
Fly 190 EYINTVNSTKHNRLSNG--LYIRNVSQADAGEYTCRAMRITPTFSDS--DQITILLRIQHKPHWF 250
Fly 251 FNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMK----- 310
Fly 311 ------NASQFGDYKCKVANPLGMLERVIK-LRPG------PKPLG 343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 17/60 (28%) |
IG_like | 256..336 | CDD:214653 | 22/91 (24%) | ||
IGc2 | 263..327 | CDD:197706 | 19/74 (26%) | ||
FN3 | 341..445 | CDD:238020 | 2/3 (67%) | ||
IGLON5 | NP_001094842.1 | Ig | 41..129 | CDD:416386 | 14/87 (16%) |
Ig strand A' | 41..46 | CDD:409353 | |||
Ig strand B | 48..56 | CDD:409353 | |||
CDR1 | 56..60 | CDD:409353 | |||
FR2 | 61..68 | CDD:409353 | 0/2 (0%) | ||
Ig strand C | 61..67 | CDD:409353 | 0/1 (0%) | ||
CDR2 | 69..79 | CDD:409353 | 3/24 (13%) | ||
Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 8/34 (24%) | ||
Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 0/12 (0%) | ||
Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 134..199 | CDD:404760 | 19/78 (24%) | ||
Ig strand B | 148..157 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 162..170 | CDD:409353 | 3/17 (18%) | ||
Ig strand F | 191..199 | CDD:409353 | 5/11 (45%) | ||
Ig strand G | 202..212 | CDD:409353 | 2/9 (22%) | ||
Ig_3 | 217..295 | CDD:404760 | 19/88 (22%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 1/7 (14%) | ||
Ig strand B | 234..238 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 247..251 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 274..278 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143449 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.700 |