DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and dpr10

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:177 Identity:36/177 - (20%)
Similarity:58/177 - (32%) Gaps:56/177 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRDAMVNCFVEGMPAPEVSWLYNGEY----INTVNSTKHNRLSNG---------LYIRNVSQADA 217
            |:.|.:.|.|:.:....|:|:.:.:.    :.|...|...|....         |.|:...|.||
  Fly    68 GKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDA 132

  Fly   218 GEYTCRAMRITPTFSDSDQITILLRIQHKP----HWFFNETL---------------------PV 257
            |.|.|: :...|..|.|..:.|:..|..:.    ..::|:..                     |:
  Fly   133 GVYECQ-ISTQP
VRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPI 196

  Fly   258 Q---------------YAYVGGAVNLSC--DAMGEPPPSFTWLHNNK 287
            |               |...|..:||:|  ....|||....|.|.:|
  Fly   197 QTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/70 (24%)
IG_like 256..336 CDD:214653 13/49 (27%)
IGc2 263..327 CDD:197706 10/27 (37%)
FN3 341..445 CDD:238020
dpr10NP_729591.1 Ig 63..143 CDD:299845 17/75 (23%)
IG_like 210..297 CDD:214653 11/34 (32%)
IGc2 217..287 CDD:197706 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.