DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and dpr13

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:384 Identity:82/384 - (21%)
Similarity:130/384 - (33%) Gaps:85/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLSQNAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTVQKDI 76
            |:.:....|..|..|.|:|...|.|........||     .|.||:.| :|::.|:......:.:
  Fly    25 LIFIIAYIAACGICDHTASASPGGGKTVAATMTTP-----ASEPSVRH-INQNLIMSQSKEGEPV 83

  Fly    77 DTKWRDPRGQTRENTKGRVHIEKKTTGLL-------------ALVFEHI-----ALEDRGNWTCE 123
            ...  .|..|:..:..|.......:|.::             |::..|.     |.:..|.:...
  Fly    84 PVP--QPYAQSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPYPIP 146

  Fly   124 VNGNRNGNRNVNVEREFLASFELLVNQKISFG-KTEQVQSVREGRDAMVNCFVEGMPAPEVSWLY 187
            |:.......::..........|.|....:.|| :...|.:.:.|..|.|.|.|..:....|||:.
  Fly   147 VHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIR 211

  Fly   188 NGEY-INTVNST-------------KHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQIT 238
            ..:| :.||..|             ||:. ...|.|:.|...|||.|.|:.....||       :
  Fly   212 KKDYHLLTVGLTTYSSDERFSATHLKHSE-DWTLQIKFVQLRDAGVYECQVSTHPPT-------S 268

  Fly   239 ILLRIQHKPHWFFNETL------PVQYAYVGGAVNLSCDAMGEPPPS--FTWLHNNKGIVGFNHR 295
            |.|      |....|..      |::|...|..:.|.|..:.....|  ..|.|:|:.|   |:.
  Fly   269 IFL------HLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMI---NYD 324

  Fly   296 IFVADYG-----------ATLQLQMKNASQFGDYKCKVAN--PLGMLERVIKLRPGPKP 341
            |   |.|           :.|.:|.......|::.|..:|  |..:|..:.|   |..|
  Fly   325 I---DRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFK---GDNP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 22/72 (31%)
IG_like 256..336 CDD:214653 22/94 (23%)
IGc2 263..327 CDD:197706 18/78 (23%)
FN3 341..445 CDD:238020 1/1 (100%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 28/109 (26%)
IG_like 182..262 CDD:214653 23/80 (29%)
IG_like 285..362 CDD:214653 18/82 (22%)
IGc2 292..361 CDD:197706 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.