DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and ImpL2

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:278 Identity:58/278 - (20%)
Similarity:102/278 - (36%) Gaps:68/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCSLLLLLLSQNAAILGQ---LDSTSSGGSGTGGAPPDRP-------------PTPPLSLQPSTP 55
            :|:|.|||....|.:.|:   |...|:....:..|..::|             .|||..||.:..
  Fly     9 VCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADG 73

  Fly    56 SITHFVNESFIIFCQTVQKDIDT-KW---RDPRGQTRENTKGRVHIEKKTTGLLAL----VFEHI 112
            :....|       |:.:...:.: :|   ..||.:..:....:| .|:..:.::.:    :.:|:
  Fly    74 ATIEIV-------CEMMGSQVPSIQWVVGHLPRSELDDLDSNQV-AEEAPSAIVRVRSSHIIDHV 130

  Fly   113 ALEDRGNWTCEVNGNRNGNRNV--------------NVEREFLASFELLVNQKISFGKTEQVQSV 163
            ..|.| .:||.   .|.|::.:              ..|:.:..:      ||.....||:....
  Fly   131 LSEAR-TYTCV---GRTGSKTIYASTVVHPPRSSRLTPEKTYPGA------QKPRIIYTEKTHLD 185

  Fly   164 REGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNG-LYIRNVSQADAGEYTCRAMRI 227
            ..|.:..:.|.|...|..|::|| |.|....|...:|..|:|| |.|..:...|.|.|.|.|..:
  Fly   186 LMGSNIQLPCRVHARPRAEITWL-NNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNV 249

  Fly   228 T----------PTFSDSD 235
            .          |..::.|
  Fly   250 VGKDTADTFVYPVLNEED 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 20/59 (34%)
IG_like 256..336 CDD:214653
IGc2 263..327 CDD:197706
FN3 341..445 CDD:238020
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/64 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.