DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and robo1

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:406 Identity:94/406 - (23%)
Similarity:137/406 - (33%) Gaps:109/406 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 WRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASF 144
            |:...|....:....:|.||      :|...:|...|.|.:.||.:.|..         :..|..
  Fly   288 WKKEEGNIPVSRARILHDEK------SLEISNITPTDEGTYVCEAHNNVG---------QISARA 337

  Fly   145 ELLVNQKISFGKTEQVQSVREGRDAMVN--CFVEGMPAPEVSWLYNG----EYINTVNSTKHNRL 203
            .|:|:...:|  |::..:.:.|.:.:|.  |...|.|.|.|.|...|    .:.|:.:..:|...
  Fly   338 SLIVHAPPNF--TKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAA 400

  Fly   204 SNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLR-----------IQHKPHWFFNETLPV 257
            ...|.|.:|.|.|.|.|.|.|..:.    ||..:.:.|:           ||..|   .|:||| 
  Fly   401 DGTLQITDVRQEDEGYYVCSAFSVV----DSSTVRVFLQVSSLDERPPPIIQIGP---ANQTLP- 457

  Fly   258 QYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKV 322
                .|....|.|.|.|.|.|...|.|:...:...|....:  .|::|::.....|..|.|.|..
  Fly   458 ----KGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSII--QGSSLRVDDLQLSDSGTYTCTA 516

  Fly   323 ANPLGMLERVIKL---RPG-------------PKPLGPRRFQLKKLYTNGFELDIQTPRMSNVSD 371
            :...|.......|   :||             |.|.|                   ||::.|||.
  Fly   517 SGERGETSWAATLTVEKPGSTSLHRAADPSTYPAPPG-------------------TPKVLNVSR 562

  Fly   372 EM----------------QIYGYRVAYMS-DTEFKFSAGNWSYAKQRDFSFHGGKHFIIPHLETN 419
            ..                .|.||.|.|.| |.:     ..|..|.||    .|.....|..|...
  Fly   563 TSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQ-----TGWIVAAQR----VGDTQVTISGLTPG 618

  Fly   420 TTYLMRAASRNLAGLS 435
            |:|:....:.|..|:|
  Fly   619 TSYVFLVRAENTQGIS 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/64 (30%)
IG_like 256..336 CDD:214653 19/82 (23%)
IGc2 263..327 CDD:197706 16/63 (25%)
FN3 341..445 CDD:238020 26/112 (23%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352 14/67 (21%)
Ig3_Robo 272..341 CDD:143202 14/67 (21%)
IG_like 351..436 CDD:214653 23/88 (26%)
Ig 362..444 CDD:299845 22/85 (26%)
I-set 445..531 CDD:254352 25/95 (26%)
IGc2 459..521 CDD:197706 16/63 (25%)
FN3 549..637 CDD:238020 27/114 (24%)
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.