DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Lac

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:317 Identity:75/317 - (23%)
Similarity:122/317 - (38%) Gaps:51/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SLQPSTPSITHFVNESFIIFCQTVQKDIDTKW------------RDP----RGQTRENTKGRVHI 97
            :|...||:|::...|.......||:.|...::            .||    .|.|......|..:
  Fly    23 TLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSL 87

  Fly    98 E-KKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQK--ISFGKTEQ 159
            . ...:....|..:.|...|.|.:||:|        .::...:..|..:|.|.:.  ||...|:.
  Fly    88 RYDPNSSTYKLQIKDIQETDAGTYTCQV--------VISTVHKVSAEVKLSVRRPPVISDNSTQS 144

  Fly   160 VQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRA 224
            |.: .||.:..:.|:..|.|.|.::|......|...:|..:  :.|.|.|::|.:.|.|.|.|.|
  Fly   145 VVA-SEGSEVQMECYASGYPTPTITWRRENNAILPTDSATY--VGNTLRIKSVKKEDRGTYYCVA 206

  Fly   225 MRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGA----VNLSCDAMGEPPPSFTW--- 282
               ....|..|:..|.:.::..|      .:.|....:|.|    ::|.|.....|||:..|   
  Fly   207 ---DNGVSKGDRRNINVEVEFAP------VITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKD 262

  Fly   283 ---LHNNKGIVGFNHRIFVADY-GATLQLQMKNASQFGDYKCKVANPLGMLERVIKL 335
               |.||:. ...:|.....:| .:||::......|:|||.||..|..|..|..:.|
  Fly   263 DIQLANNQH-YSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 13/68 (19%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 23/85 (27%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 2/3 (67%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 26/91 (29%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/9 (11%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 3/4 (75%)
FN3 341..445 CDD:238020
LacNP_523713.2 IG_like 36..131 CDD:214653 18/102 (18%)
Ig strand B 46..50 CDD:409381 1/3 (33%)
Ig strand C 60..63 CDD:409381 0/2 (0%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 22/79 (28%)
Ig 227..318 CDD:472250 25/91 (27%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.