Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006247755.1 | Gene: | Sdk2 / 360652 | RGDID: | 1310397 | Length: | 2175 | Species: | Rattus norvegicus |
Alignment Length: | 365 | Identity: | 75/365 - (20%) |
---|---|---|---|
Similarity: | 109/365 - (29%) | Gaps: | 156/365 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 TGGAPPDRPP---TPPLSLQPSTPSITHFVNESFIIFCQTVQK-DIDTKWRDPRGQTRENTKGRV 95
Fly 96 HIEKKTTGLLALVFEHIALEDR---GNWTCEVNGNRNG---NRNVNVEREFLASFELLVNQKISF 154
Fly 155 GKTEQVQSVREGRDAMVNC-FVEGMPAPEVSWLYNGE---------------------------- 190
Fly 191 -YINTVNSTKHNR---------------------------------------------------- 202
Fly 203 ------------LSNG-------LYIRNVSQADAGEYTCRAM----RITPTFSDSDQITILLRIQ 244
Fly 245 HKPHWFFNETLPVQY--AYVGGAVNLSCDAMGEPPPSFTW 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 22/159 (14%) |
IG_like | 256..336 | CDD:214653 | 12/29 (41%) | ||
IGc2 | 263..327 | CDD:197706 | 10/20 (50%) | ||
FN3 | 341..445 | CDD:238020 | |||
Sdk2 | XP_006247755.1 | IG_like | 43..112 | CDD:214653 | 18/83 (22%) |
IGc2 | 43..101 | CDD:197706 | 15/72 (21%) | ||
IG_like | 123..206 | CDD:214653 | 13/82 (16%) | ||
Ig | 135..191 | CDD:299845 | 7/55 (13%) | ||
IG_like | 225..307 | CDD:214653 | 15/82 (18%) | ||
IGc2 | 236..289 | CDD:197706 | 12/52 (23%) | ||
I-set | 311..400 | CDD:254352 | 14/37 (38%) | ||
Ig | 329..397 | CDD:143165 | 10/17 (59%) | ||
I-set | 405..495 | CDD:254352 | |||
Ig | 419..495 | CDD:299845 | |||
Ig | 505..589 | CDD:299845 | |||
IG_like | 505..589 | CDD:214653 | |||
FN3 | 593..684 | CDD:238020 | |||
FN3 | 696..789 | CDD:238020 | |||
FN3 | 797..893 | CDD:238020 | |||
FN3 | 898..986 | CDD:238020 | |||
FN3 | 996..1090 | CDD:238020 | |||
FN3 | 1102..1197 | CDD:238020 | |||
FN3 | 1204..1293 | CDD:238020 | |||
FN3 | 1304..1397 | CDD:238020 | |||
FN3 | 1403..1487 | CDD:238020 | |||
FN3 | 1506..1619 | CDD:238020 | |||
FN3 | 1629..1722 | CDD:238020 | |||
FN3 | 1727..1808 | CDD:238020 | |||
FN3 | 1840..1919 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |