DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and fipi

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:406 Identity:155/406 - (38%)
Similarity:244/406 - (60%) Gaps:23/406 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LSLQPSTPSITHFVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHI 112
            |||.|:..|:..:.|||.|:.|::....::..|:.|:|:.....|||:|||:.:|..|.:||.||
  Fly    25 LSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHI 89

  Fly   113 ALEDRGNWTCE-VNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVE 176
            ||.|:|||:|| .:|:.:..           ||:|:|.|||:|.:...|.:|:||..|.:.|.|:
  Fly    90 ALADKGNWSCEAADGSLHSK-----------SFDLIVYQKITFTENATVMTVKEGEKATILCEVK 143

  Fly   177 GMPAPEVSWLYNGEYIN--TVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITI 239
            |.|.|.|:|.:||:.|:  ..:.:|...|::||.|..|:|.|.|||.|||.::....||..:.|:
  Fly   144 GEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERTV 208

  Fly   240 LLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWL--HNNKGIVGFNHRIFVA--- 299
            |::|:|||.|.....:.::|||:.|...|.|:|:.|||.:|||.  ||.   :..|:|::..   
  Fly   209 LMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNK---LHSNNRLYTIQSD 270

  Fly   300 DYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGPKPLGPRRFQLKKLYTNGFELDIQTP 364
            .|.::|.:.:.|.|.|.:|:|:..|.||.:||..:|..|.||..|..|||:...:|.|::.:..|
  Fly   271 SYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAP 335

  Fly   365 RMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFHGGKHFIIPHLETNTTYLMRAASR 429
            | ......|.:.|:|:.||::.|||..||.|:.|:::|::|..|..|::.:||.:|.||:|||||
  Fly   336 R-GPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASR 399

  Fly   430 NLAGLSDWSPVKVFTT 445
            ||||.||::.|:.:.|
  Fly   400 NLAGFSDFTKVEKYKT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 25/60 (42%)
IG_like 256..336 CDD:214653 29/84 (35%)
IGc2 263..327 CDD:197706 22/68 (32%)
FN3 341..445 CDD:238020 42/103 (41%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 33/92 (36%)
I-set 128..202 CDD:254352 28/73 (38%)
Ig 133..>193 CDD:299845 24/59 (41%)
IG_like 228..307 CDD:214653 29/81 (36%)
Ig 235..305 CDD:143165 25/72 (35%)
FN3 312..415 CDD:238020 42/103 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460736
Domainoid 1 1.000 50 1.000 Domainoid score I7827
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28418
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016767
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2305
87.850

Return to query results.
Submit another query.