DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and dpr3

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:353 Identity:68/353 - (19%)
Similarity:104/353 - (29%) Gaps:135/353 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSQNAAILGQLDSTSSG---GSGTGGAPPDRPPTPPLSLQPSTPS------ITH----------- 59
            |:..||..||.|.:..|   .:....:....|..|..|...|:||      :.|           
  Fly   130 LAAAAASTGQPDDSGDGPTLSTFLSSSQSQSPSPPAASASASSPSSFSSFAVAHGPQTEATNHTF 194

  Fly    60 ----FVNESF--IIFCQTVQK------------DIDTKWRDP-------------RGQTRENTKG 93
                |::.||  .:|.||..|            |.||....|             .|.|....|.
  Fly   195 KSLAFLDASFGSDLFAQTDAKRERSGAADEESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKC 259

  Fly    94 RVH---------IEKKTTGLLAL---------VFEHIALEDRGNWTCEVN---GNRNG--NRNVN 135
            ||.         |.|:...:|.:         .|:....:|...||..|.   ...:|  ...||
  Fly   260 RVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVN 324

  Fly   136 VEREFLASFELLVNQKISFGKTEQVQS-----VREGRDAMVNCFVEGMPAPEVS---WLYNGEYI 192
            .|.:...:|:|.:.: ||......:..     .:.|...::||.|:.....::.   | |.||::
  Fly   325 TEPKMSMAFQLNIIE-ISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGPIYW-YRGEHM 387

  Fly   193 NT----------------------------------------------VNSTKHNRLSNGLYIRN 211
            .|                                              :.|...:.|.:.|.|.|
  Fly   388 ITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISN 452

  Fly   212 VSQADAGEYTCRAMRITPTFSDSDQITI 239
            ....|.|.|||:     ||.:.|..:.:
  Fly   453 AQTTDTGNYTCQ-----PTTASSASVLV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/107 (18%)
IG_like 256..336 CDD:214653
IGc2 263..327 CDD:197706
FN3 341..445 CDD:238020
dpr3NP_001014459.2 Ig 243..330 CDD:299845 17/86 (20%)
IG_like 243..329 CDD:214653 17/85 (20%)
Ig 350..464 CDD:299845 18/114 (16%)
IG_like <441..477 CDD:214653 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.