DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and dpr18

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:395 Identity:72/395 - (18%)
Similarity:121/395 - (30%) Gaps:151/395 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PTPPLSLQPS-------TPSITHFVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKT 101
            |..|:..:.|       ||....|.:.|..|      |::.|            |.....:...|
  Fly   121 PHSPIPTKMSRGKIPMETPGSMEFSSNSLPI------KNVGT------------TDQLTTVTMPT 167

  Fly   102 TGLLALVFEHIALED-------RGNWTCE--------------------------VNGNRNGNRN 133
            |...:|..:...::.       |.:||..                          :|...:|:..
  Fly   168 TAFASLKVDRSTMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNL 232

  Fly   134 VNVEREFLASFELLVNQKISFGKTEQVQSVREGRD-----AMVNCFVEGMPAPEVSWLYNGEYIN 193
            |:....|.   |.::|.::...|.:.|..||...:     .:.|....|.|...|.:.|...:..
  Fly   233 VSAVHLFT---EAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRL 294

  Fly   194 TVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITIL---LRI--QHKPHWFFNE 253
            .:|.|:              ..|||.|.|:.....|....:: :|:|   |||  :|:      .
  Fly   295 LINPTQ--------------TEDAGVYMCQVSTHPPRVFTTN-LTVLEPPLRIIDEHE------R 338

  Fly   254 TLPVQYAYVGGAVNLSC----------------------DAM----------------------- 273
            .:..:|...|..|:|.|                      ||:                       
  Fly   339 DVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHK 403

  Fly   274 --GEPPPSF-----TWLHNNKGIVGF-NHRIFVADYGATLQLQMKNA--SQFGDYKCKVANPLGM 328
              |:....:     ||..:.:.:.|. |.|:.|:|...|.::.:.:|  |..|:|.|.    ||.
  Fly   404 FSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCS----LGR 464

  Fly   329 LERVI 333
            |..||
  Fly   465 LFTVI 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 12/63 (19%)
IG_like 256..336 CDD:214653 26/133 (20%)
IGc2 263..327 CDD:197706 20/118 (17%)
FN3 341..445 CDD:238020
dpr18NP_573102.1 IG_like 242..325 CDD:214653 18/97 (19%)
Ig <258..326 CDD:299845 16/82 (20%)
IGc2 <417..461 CDD:197706 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.