DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Negr1

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:358 Identity:76/358 - (21%)
Similarity:124/358 - (34%) Gaps:112/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIALCSLL---------------LLLLSQNAAILG-QLDSTSSGGSGTGGAPPDRPPTPPLSLQP 52
            |::|||.|               :|:...:.|:|. .|:..:|.|:                   
Mouse    19 LLSLCSCLPAGQSVDFPWAAVDNMLVRKGDTAVLRCYLEDGASKGA------------------- 64

  Fly    53 STPSITHFVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALED 116
                   ::|.|.|||..      ..||. ||          ||.|........:|..:::.:.|
Mouse    65 -------WLNRSSIIFAG------GDKWSVDP----------RVSISTLNKRDYSLQIQNVDVTD 106

  Fly   117 RGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAP 181
            .|.:||.|. .::..|.:.|        .|.|.............::.||.:..:.|...|.|.|
Mouse   107 DGPYTCSVQ-TQHTPRTMQV--------HLTVQVPPKIYDISNDMTINEGTNVTLTCLATGKPEP 162

  Fly   182 EVSWLY---------NGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQI 237
            .:||.:         ||:|::               |..:::..||||.|.|.. ..:|.|..::
Mouse   163 VISWRHISPSAKPFENGQYLD---------------IYGITRDQAGEYECSAEN-DVSFPDVKKV 211

  Fly   238 TILLRIQHKPHWFFNETLPVQYAYVGGAVN------LSCDAMGEPPPSFTWLHNNKGIVGFNHRI 296
            .:::..           .|.......|.|.      :.|:..|.|||:|.|....|.:......|
Mouse   212 RVIVNF-----------APTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKRLFNGQQGI 265

  Fly   297 FVADYGATLQLQMKNASQ--FGDYKCKVANPLG 327
            .:.::.....|.:.|.:|  ||:|.|..||.||
Mouse   266 IIQNFSTRSILTVTNVTQEHFGNYTCVAANKLG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 11/52 (21%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 20/94 (21%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 0/3 (0%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 23/80 (29%)
Ig strand B 266..270 CDD:409353 1/9 (11%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353 1/6 (17%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020
Negr1XP_036019026.1 IG_like 41..129 CDD:214653 27/138 (20%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 62..66 CDD:409353 1/29 (3%)
Ig strand E 95..99 CDD:409353 1/3 (33%)
Ig strand F 109..114 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig_3 132..201 CDD:464046 18/83 (22%)
IG_like 225..306 CDD:214653 22/74 (30%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.