DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:384 Identity:88/384 - (22%)
Similarity:140/384 - (36%) Gaps:99/384 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TPPLSLQPSTPSITHFVNESFIIFCQTVQKDID-TKWRDPRGQTR-------------ENTKGR- 94
            ||.|:..||....|....:      ||.|:|.| .::.:|.....             ||.||. 
  Fly    46 TPTLAEIPSKGKHTRLDTQ------QTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYK 104

  Fly    95 ---VHIEKKT-----------TGLLALVF----------EHIALEDRGNWTCEVNGNRNGNRNVN 135
               |.::.:|           ...::|.:          :.:...|||.:.|:||.:...:|.  
  Fly   105 VAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRK-- 167

  Fly   136 VEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSW--------LYNGEYI 192
                  ...:::|...|..|.|.....||||::..:.|...|.|.|.|.|        |..||::
  Fly   168 ------GYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHV 226

  Fly   193 NTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMR-ITPTFSDSDQITILLRIQHKPHWFFNETLP 256
            |.|:...       |:|..||:.....|.|.|.. :.|:.|.    .:.||:|..|..    ::|
  Fly   227 NVVDGEL-------LHITKVSRLHMAAYLCVASNGVPPSISK----RVHLRVQFPPML----SIP 276

  Fly   257 VQY--AYVGGAVNLSCDAMGEPPPSFTWLHNNKGIV---------GFNHRIFVADYGATLQLQMK 310
            .|.  ||:|..|.|.|.....|.....|......::         .:.....|:.|...::|:::
  Fly   277 NQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIR 341

  Fly   311 --NASQFGDYKCKVANPLGMLERVIKLRPGPKP---------LGPRRFQLKKLYTNGFE 358
              ..:.||.|:|...|.||..:..|||...|.|         |..|.:..|:.:.|.|:
  Fly   342 AVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAIISEMSLLNRSYDGKRRHRNKFD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/66 (29%)
IG_like 256..336 CDD:214653 22/92 (24%)
IGc2 263..327 CDD:197706 14/74 (19%)
FN3 341..445 CDD:238020 6/27 (22%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 14/99 (14%)
IG_like 82..174 CDD:214653 14/99 (14%)
IG_like 184..267 CDD:214653 25/93 (27%)
IGc2 191..255 CDD:197706 20/70 (29%)
IG_like 282..368 CDD:214653 19/85 (22%)
Ig 288..367 CDD:143165 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.