DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Prtg

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001032740.2 Gene:Prtg / 315806 RGDID:1307157 Length:1193 Species:Rattus norvegicus


Alignment Length:377 Identity:84/377 - (22%)
Similarity:136/377 - (36%) Gaps:73/377 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EDRGNWTCEVNGNRNGNRNVNVEREFLASFELL-VNQKISFGKTEQVQSVRE-----GRDAMVNC 173
            ||.|.:.|....:.:..:::.      ||..:: .|:..||.....:.|.:.     .:..::.|
  Rat   193 EDAGKYRCVAATHAHKRKSME------ASLTIVPANETRSFYMPTIIASPQNVTASLHQTVVLEC 251

  Fly   174 FVEGMPAPEVSW-LYNGEYINTVNSTKHNRLSNG-LYIRNVSQADAGEYTCRAMRITPTFSDSDQ 236
            ...|.|.|.:|| ..:.:.|:..|:   ..|.|| |.|.:|....||.|.|||  .||...:...
  Rat   252 MATGYPKPIISWSRLDHKSIDVFNT---RVLGNGNLIISDVKLQHAGVYVCRA--TTPGTRNFTV 311

  Fly   237 ITILLRIQHKP---HWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFV 298
            ....|.:...|   .|..:.|.|     ..|.....|.|.|.|.|..:||.|.:.|.. |.||.:
  Rat   312 AMATLTVLAPPSFVEWPESLTRP-----RAGTARFVCQAEGIPSPKMSWLKNGRRIHS-NGRIKM 370

  Fly   299 ADYGATLQLQMKNASQFGDYKCKVANPLGML---ERVIKLRPGPKPLGPRRFQLKKLYTNGFELD 360
              |.:.|.:..........|:|...|..|.:   .|:..:....:|..|.....:.:.::...|.
  Rat   371 --YNSKLVINQIIPEDDAIYQCMAENSQGSVLSRARLTVVMSEDRPSAPYNVHAETMSSSAILLA 433

  Fly   361 IQTPRMSNVSDEMQIYGYRVAYM-----SDTEFKFSAGNWSYAKQRDFSFHGGKHFIIPHLETNT 420
            .:.|..:  ||  ::..|.|.||     ::.|::...||            ...|:||..||.::
  Rat   434 WERPLYN--SD--KVIAYSVHYMKAEGLNNEEYQVVLGN------------DTTHYIIDDLEPDS 482

  Fly   421 TYLMRAASRNLAGLSDWS--------------PVKVFTTAAG-----CSWSP 453
            .|.....:....|.|..|              |.::..|:..     .||.|
  Rat   483 NYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLP 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 18/65 (28%)
IG_like 256..336 CDD:214653 21/82 (26%)
IGc2 263..327 CDD:197706 18/63 (29%)
FN3 341..445 CDD:238020 23/122 (19%)
PrtgNP_001032740.2 Ig 32..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 38..44 CDD:409353
Ig strand B 48..58 CDD:409353
Ig strand C 62..68 CDD:409353
Ig strand C' 70..73 CDD:409353
Ig strand D 78..83 CDD:409353
Ig strand E 85..91 CDD:409353
Ig strand F 103..110 CDD:409353
Ig strand G 114..124 CDD:409353
Ig 131..218 CDD:416386 6/30 (20%)
Ig strand B 146..150 CDD:409353
Ig strand C 159..163 CDD:409353
Ig strand E 183..187 CDD:409353
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/8 (0%)
Ig_3 230..302 CDD:404760 21/76 (28%)
Ig strand B 247..251 CDD:409353 0/3 (0%)
Ig strand C 260..264 CDD:409353 1/3 (33%)
Ig strand E 282..286 CDD:409353 2/3 (67%)
Ig strand F 296..301 CDD:409353 2/4 (50%)
I-set 322..407 CDD:400151 24/92 (26%)
Ig strand C 352..357 CDD:409353 1/4 (25%)
Ig strand C' 359..362 CDD:409353 0/2 (0%)
Ig strand D 367..371 CDD:409353 2/5 (40%)
Ig strand E 373..378 CDD:409353 1/4 (25%)
Ig strand F 387..394 CDD:409353 2/6 (33%)
Ig strand G 398..407 CDD:409353 1/8 (13%)
FN3 414..507 CDD:238020 22/108 (20%)
FN3 512..605 CDD:238020 5/23 (22%)
fn3 619..694 CDD:394996
FN3 721..809 CDD:238020
FN3 816..906 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 974..1018
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1078..1193
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.