DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Kirrel3

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus


Alignment Length:312 Identity:73/312 - (23%)
Similarity:119/312 - (38%) Gaps:63/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PPTPPLSLQPSTPSITHFVNESFIIF-CQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLL 105
            ||...||::|..     .:.::.:.| |........|::| ..||...:...|.::   :||...
  Rat   249 PPLVNLSVEPQP-----VLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELY---RTTVDY 305

  Fly   106 ALVFEHIALEDRGNWTCEVN---GNRNGNRNVNVEREFLASFELLVNQKISFG--KTEQVQS--V 163
            ....|.:        :|||.   |:.|.:|.|:|                .||  .|.:.||  |
  Rat   306 TYFSEPV--------SCEVTNALGSTNLSRTVDV----------------YFGPRMTSEPQSLLV 346

  Fly   164 REGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRIT 228
            ..|.||:.:|...|.|:..:.|:..|..:...|       ...|.:::|.|.|||:|.|||  :.
  Rat   347 DLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSN-------EKTLTLKSVRQEDAGKYVCRA--VV 402

  Fly   229 PTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPP---SFTWLHN--NKG 288
            |.....:: .:.|.:...|.....:|   |:|..|....:.|.....|||   :::|..|  ..|
  Rat   403 PRVGAGER-EVTLTVNGPPIISSTQT---QHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESG 463

  Fly   289 IVG-FNHRIFVADYGATLQLQMKN--ASQFGD-YKCKVANPLGMLERVIKLR 336
            ..| :.......:.|....|.:.|  .:.|.. |.|...|..|....:|:|:
  Rat   464 TSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/58 (29%)
IG_like 256..336 CDD:214653 20/88 (23%)
IGc2 263..327 CDD:197706 16/72 (22%)
FN3 341..445 CDD:238020
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416
Ig strand E 210..214 CDD:409416
Ig strand F 224..229 CDD:409416
Ig strand G 239..242 CDD:409416
Ig <267..334 CDD:416386 18/93 (19%)
Ig strand B 267..274 CDD:409353 2/6 (33%)
Ig strand C 279..286 CDD:409353 2/6 (33%)
Ig strand C' 288..291 CDD:409353 1/2 (50%)
Ig strand D 298..302 CDD:409353 0/6 (0%)
Ig strand E 304..310 CDD:409353 0/5 (0%)
Ig strand G 321..334 CDD:409353 5/28 (18%)
Ig 335..416 CDD:416386 25/90 (28%)
Ig strand A' 343..347 CDD:409353 1/3 (33%)
Ig strand B 350..360 CDD:409353 3/9 (33%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 1/5 (20%)
IgI_5_KIRREL3 418..515 CDD:409479 22/99 (22%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 0/3 (0%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.