DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Igsf9b

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:431 Identity:94/431 - (21%)
Similarity:143/431 - (33%) Gaps:80/431 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PPLSLQPSTPSITHFVNESFIIFCQTV----QKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLA 106
            ||..:.| ..:||..:::..::.|:..    .......|:|.....:.:.|.||.|....|    
  Rat   228 PPFIVSP-PENITVNISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGT---- 287

  Fly   107 LVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMV 171
            |:...:..||.|.:|| |..|..|       |...||..|.|...........|..|..|....:
  Rat   288 LIIFRVKPEDAGKYTC-VPSNSLG-------RSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYI 344

  Fly   172 NCFVEG-MPAPEVSWLYNGEYINTVNSTKHNRLSNG-LYIRNVSQADAGEYTCRAMRITPTFSDS 234
            .|.|:. .||..|.|..:|..:....:.....:.:| :.|...::...|.|||.......|...|
  Rat   345 RCPVDAEPPATVVKWNKDGRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTMGQS 409

  Fly   235 DQITILLR----IQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTW---------LHNN 286
            ....::|:    ....|.|.:.:.       .|..:.:.|.|.|:|.|..||         .|| 
  Rat   410 APARLVLKDPPYFTVLPGWEYRQE-------AGRELLIPCAAAGDPFPVITWRKVGKPSRSKHN- 466

  Fly   287 KGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRP-GPKPLGPRRFQLK 350
                        |....:||.:..:....|:::|...|.:..:.....|.. |..|..|...::.
  Rat   467 ------------ALPSGSLQFRALSKEDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVH 519

  Fly   351 KLYTNGFELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFH--------- 406
            ...|.           :|||.|.   ||...|    |..||.......|:..|..|         
  Rat   520 VSMTT-----------ANVSWEP---GYDGGY----EQTFSVWYGPLMKRAQFGPHDWLSLSVPL 566

  Fly   407 GGKHFIIPHLETNTTYLMRAASRNLAGLSDWSPVKVFTTAA 447
            |....::..||..|.|.....::|..|.|.:|.|....|.|
  Rat   567 GPSWLLVDSLEPETAYQFSVLAQNRLGTSAFSEVVTVNTLA 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 12/55 (22%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 18/87 (21%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 1/4 (25%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 16/88 (18%)
Ig strand B 266..270 CDD:409353 0/3 (0%)
Ig strand C 279..283 CDD:409353 2/12 (17%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 1/4 (25%)
FN3 341..445 CDD:238020 26/112 (23%)
Igsf9bNP_001363879.1 Ig 41..115 CDD:409353
Ig strand B 41..45 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 96..100 CDD:409353
Ig strand F 110..115 CDD:409353
I-set 139..225 CDD:400151
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 191..195 CDD:409353
Ig strand F 205..210 CDD:409353
Ig strand G 218..221 CDD:409353
Ig_3 228..307 CDD:464046 20/84 (24%)
Ig 336..410 CDD:472250 16/73 (22%)
Ig strand B 342..346 CDD:409544 0/3 (0%)
Ig strand C 355..360 CDD:409544 1/4 (25%)
Ig strand E 380..384 CDD:409544 1/3 (33%)
Ig strand F 394..399 CDD:409544 3/4 (75%)
Ig strand G 407..410 CDD:409544 0/2 (0%)
Ig 429..505 CDD:472250 17/95 (18%)
Ig strand B 438..442 CDD:409544 0/3 (0%)
Ig strand C 451..455 CDD:409544 1/3 (33%)
Ig strand E 471..475 CDD:409544 1/3 (33%)
Ig strand F 485..490 CDD:409544 1/4 (25%)
FN3 <490..>735 CDD:442628 31/136 (23%)
Ig strand G 498..501 CDD:409544 0/2 (0%)
FN3 510..605 CDD:238020 26/112 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.