DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and rst

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:557 Identity:113/557 - (20%)
Similarity:176/557 - (31%) Gaps:179/557 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PDRPPTPPLSLQPSTPSITHFVNESFIIFCQTVQKDIDTKWRDPR-------------------- 84
            ||:......|:...||...|. |.:|  .|| .|...|..:|..:                    
  Fly   188 PDQRRFTAKSVLRLTPKKEHH-NTNF--SCQ-AQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLP 248

  Fly    85 ----GQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGN---------WTCE----VNGNRNGNR 132
                |.......|.||:   :||...:....:.||.|.:         |...    :.|.:....
  Fly   249 GGAGGSVGGAGGGSVHM---STGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMV 310

  Fly   133 NVNVEREFLASFELLVNQKI--SFGKTEQVQ--------SVREGRDAM---------VNCFVEGM 178
            ..||.|:|   .:.:|..::  |.||:|..:        |.|:...:|         :.|.|:..
  Fly   311 IRNVTRKF---HDAIVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSN 372

  Fly   179 PAPEVSWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSD--SDQITILL 241
            |.||:.|:.:..  :.|..|..|      ...:||...||.|.|:|.  .|.:::  :|....| 
  Fly   373 PQPEIVWIQHPS--DRVVGTSTN------LTFSVSNETAGRYYCKAN--VPGYAEISADAYVYL- 426

  Fly   242 RIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEP-PPSFTWLHNNKGI---VGFNHRIFV---- 298
              :..|......|   ||..||....:.|.|...| ....:|..|.:.|   .|.::.|.|    
  Fly   427 --KGSPAIGSQRT---QYGLVGDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVP 486

  Fly   299 ADYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGPKPLGPRRFQLKKLYTNGFEL---- 359
            ....:||.::...|..:|.|.|.|.|..|.....|:|:      ..:...|......|..:    
  Fly   487 GGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQ------AKKSVSLLMTIVGGISVVAFL 545

  Fly   360 ----------------------DI----QTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYA 398
                                  |:    |..:...||.::: .|.|.:..||.:...|.|   |.
  Fly   546 LVLTILVVVYIKCKKRTKLPPADVISEHQITKNGGVSCKLE-PGDRTSNYSDLKVDISGG---YV 606

  Fly   399 KQRDFSFH---------------GGKHFIIP--------------------HLETNT---TYLMR 425
            ...|:|.|               .|...|:.                    |.:|.|   |:|..
  Fly   607 PYGDYSTHYSPPPQYLTTCSTKSNGSSTIMQNNHQNQLQLQQQQQQSHHQHHTQTTTLPMTFLTN 671

  Fly   426 AASRNLAG---------LSDWSPVKVFTTAAGCSWSP 453
            ::..:|.|         ..:..|....|||:..|.||
  Fly   672 SSGGSLTGSIIGSREIRQDNGLPSLQSTTASVVSSSP 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/67 (24%)
IG_like 256..336 CDD:214653 23/87 (26%)
IGc2 263..327 CDD:197706 18/71 (25%)
FN3 341..445 CDD:238020 26/180 (14%)
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423 12/40 (30%)
Ig_3 265..329 CDD:290638 12/69 (17%)
I-set 346..420 CDD:254352 20/83 (24%)
Ig 360..425 CDD:299845 18/74 (24%)
Ig5_KIRREL3-like 428..524 CDD:143235 25/98 (26%)
IG_like 435..524 CDD:214653 24/91 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.