DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Iglon5

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001419161.1 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:307 Identity:68/307 - (22%)
Similarity:115/307 - (37%) Gaps:71/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEV 124
            ::|.|.|::.               |..|..:..||.:...|....:::...:.|.|.|.:||..
  Rat    65 WLNRSNILYA---------------GNDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSF 114

  Fly   125 NGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNG 189
            ...         .:.:.....|:|:............:|.||.:..:.|...|.|.|.|:|    
  Rat   115 QTR---------HQPYTTQVYLIVHVPARIVNISSPVAVNEGGNVNLLCLAVGRPEPTVTW---- 166

  Fly   190 EYINTVNSTKHNRLSNG--LYIRNVSQADAGEYTCRAMRITPTFSDS--DQITILLRIQHKPHWF 250
                  ...:....|.|  |.|.::.:..||||.|    :|....:|  |...:|:.:.:.|  .
  Rat   167 ------RQLRDGFTSEGEILEISDIQRGQAGEYEC----VTHNGVNSAPDSRRVLVTVNYPP--T 219

  Fly   251 FNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMK----- 310
            ..:....:.| :|.|..|.|:||..||..|.|..::        |:..:.....|::|.:     
  Rat   220 ITDVTSARTA-LGRAALLRCEAMAVPPADFQWYKDD--------RLLSSGSAEGLKVQTERTRSM 275

  Fly   311 ------NASQFGDYKCKVANPLGMLERVIK-LRPG------PKPLGP 344
                  :|..:|:|.|:.||.||.....:: ||||      |:|.||
  Rat   276 LLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGP 322

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 9/51 (18%)
Ig strand E 105..109 CDD:409353 0/3 (0%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 21/89 (24%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 2/5 (40%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 1/4 (25%)
IG_like 256..336 CDD:214653 22/91 (24%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353 1/6 (17%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 3/4 (75%)
Iglon5NP_001419161.1 Ig 41..129 CDD:472250 14/87 (16%)
Ig strand B 50..54 CDD:409382