DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Igsf9

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001100667.1 Gene:Igsf9 / 304982 RGDID:1304566 Length:1179 Species:Rattus norvegicus


Alignment Length:557 Identity:103/557 - (18%)
Similarity:169/557 - (30%) Gaps:185/557 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTV---QKDIDTKWRDPRGQTRENTKGRVH 96
            |..:||....||||.|:...       .|:..:.|..:   |..:..|:   |||.....:|:|.
  Rat   131 TVNSPPQFQETPPLVLEVKE-------LEAVTLRCVALGSPQPYVTWKF---RGQDLGKGQGQVQ 185

  Fly    97 IEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQ 161
            :...|     |....:.....|::||:.:         :.|.....:.:|||.............
  Rat   186 VRNGT-----LWIRRVERGSAGDYTCQAS---------STEGSVTHTTQLLVLGPPVIVVPPNNN 236

  Fly   162 SVREGRDAMVNCFVEGMPAP-EVSWL---YNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTC 222
            :|...:|..:.|..|..||. ..||.   .|..:|:.:.|.....:...|:::.....|||.|||
  Rat   237 TVNASQDVSLACRAEAYPANLTYSWFQDRINVFHISRLQSRVRILVDGSLWLQATQPDDAGHYTC 301

  Fly   223 RAMRITP---------TFSDSDQITIL-----------------------------------LRI 243
            ......|         |.....|:|::                                   |::
  Rat   302 VPSNGFPHPPSASAYLTVLYPAQVTVMPPETPLPIGMRGVIRCPVRANPPLLFVTWTKDGQALQL 366

  Fly   244 QHKPHW-----------------------------------------------FFNETLPVQYAY 261
            ...|.|                                               |.::.....:..
  Rat   367 DKFPGWSLGPEGSLVIALGNEDALGEYSCTPYNSLGTAGSSPVTRVLLKAPPAFIDQPKEEYFQE 431

  Fly   262 VGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKVANPL 326
            ||..:.:.|.|.|:|||..:|....:|:.|...    .|...:|.|:.......|.::|...|.:
  Rat   432 VGRDLLIPCSARGDPPPIVSWAKVGRGLQGQAQ----VDSNNSLILRPLTKEAHGRWECSARNAV 492

  Fly   327 GMLERVIKLRPGPKPLGPRRFQLKKLYTNGFELD-----------IQTPRMSNVSDEMQIYGYRV 380
            ..:                     .:.||.:.|.           :..|:.:|||.|.   |:..
  Rat   493 AHV---------------------TISTNVYVLGTSPHVVTNVSVVPLPKGANVSWEP---GFDG 533

  Fly   381 AYMSDTEFKFSAGNWSYAKQRDFSFH---------GGKHFIIPHLETNTTYLMRAASRNLAGLSD 436
            .|:.    :||......||:.|.:.|         |..|.::|.|:..|.|.....::|..|...
  Rat   534 GYLQ----RFSVWYTPLAKRPDRAHHDWVSLAVPMGATHLLVPGLQAYTQYQFSVLAQNKLGSGP 594

  Fly   437 WS------PVKVFTTAA-----GCSWSPWLYPSYGLI 462
            :|      |..:.||.|     .....|.|.|..||:
  Rat   595 FSEIVLSIPEGLPTTPAVPRLPPTEMPPPLSPPRGLV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 11/54 (20%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 21/98 (21%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 17/79 (22%)
Ig strand B 266..270 CDD:409353 0/3 (0%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 1/4 (25%)
FN3 341..445 CDD:238020 26/129 (20%)
Igsf9NP_001100667.1 IG_like 28..110 CDD:214653
Ig strand B 37..41 CDD:409353
Ig strand C 54..58 CDD:409353
Ig strand E 91..95 CDD:409353
IG_like 143..223 CDD:214653 19/103 (18%)
Ig strand B 154..158 CDD:409353 0/3 (0%)
Ig strand C 167..171 CDD:409353 0/3 (0%)
Ig strand E 189..193 CDD:409353 2/8 (25%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig strand G 216..219 CDD:409353 0/2 (0%)
Ig_3 226..305 CDD:464046 18/78 (23%)
Ig 322..407 CDD:472250 5/84 (6%)
Ig strand B 333..344 CDD:409353 0/10 (0%)
Ig strand C 353..358 CDD:409353 0/4 (0%)
Ig strand E 378..382 CDD:409353 0/3 (0%)
Ig strand F 392..397 CDD:409353 0/4 (0%)
Ig 418..503 CDD:472250 20/109 (18%)
Ig strand B 436..440 CDD:409353 0/3 (0%)
Ig strand C 449..453 CDD:409353 0/3 (0%)
Ig strand E 469..473 CDD:409353 1/3 (33%)
Ig strand F 483..488 CDD:409353 1/4 (25%)
Ig strand G 496..499 CDD:409353 0/2 (0%)
FN3 508..599 CDD:238020 22/97 (23%)
FN3 625..715 CDD:238020 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 766..807
PHA03247 <777..1062 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..846
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 869..895
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..979
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.