DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Vsig10

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001258265.1 Gene:Vsig10 / 304529 RGDID:1565800 Length:564 Species:Rattus norvegicus


Alignment Length:337 Identity:67/337 - (19%)
Similarity:100/337 - (29%) Gaps:143/337 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ALVFEHIALEDRGNWTCEVNGNR-----------NGNRNVNVEREFLASFELLVNQKISFGKTEQ 159
            ||..|.:.|||.||:||....|.           :|..:::|.   :::...|.|..:...:..|
  Rat   113 ALRIEALRLEDDGNYTCREVLNETHWFPVQLRVTSGPAHIDVN---ISATGTLPNGTLYAARGSQ 174

  Fly   160 VQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKH----NRLSNGLYIRNVSQADAGEY 220
            |.         .:|.....|.|||.|     :|.|.:|...    |..:|...:..:|:...|.|
  Rat   175 VD---------FSCCSAAQPPPEVEW-----WIQTHSSVSESLGKNLSANSFTLMLMSKNLQGNY 225

  Fly   221 TCRAMRITPTFSDSDQITILLRIQHK--------------------------------------- 246
            ||.|            ..:|.|.|.|                                       
  Rat   226 TCSA------------TNVLSRRQRKVTTELLVYWPPPSAPQCSAGLSPESANLELTCNWDGGYP 278

  Fly   247 -PHWFFNE-------------TL---------------------------------------PVQ 258
             |.:.:.|             ||                                       |::
  Rat   279 DPTFLWTEEPGGVVVGNSKLQTLSPSQLSEGKKFKCVGSHILGPESGASCVVQISSPLLASRPMK 343

  Fly   259 YAYVGGAVNLSCDAMG-EPPPSFTWLHN---NKGIVGFNHRIFVADYGATLQLQMKNASQFGD-- 317
            ...|||.|.|:|...| .||....||.|   .:..:..:.|..:...|.:..|.:.|.||..|  
  Rat   344 TCLVGGDVTLTCQVEGANPPARIQWLRNLTQPETAIQPSSRYVITQQGQSSSLTIHNCSQDQDGG 408

  Fly   318 -YKCKVANPLGM 328
             |.|:..||:|:
  Rat   409 FYFCRAENPVGV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/62 (26%)
IG_like 256..336 CDD:214653 25/80 (31%)
IGc2 263..327 CDD:197706 22/70 (31%)
FN3 341..445 CDD:238020
Vsig10NP_001258265.1 Ig 60..146 CDD:299845 11/32 (34%)
IG_like 60..145 CDD:214653 11/31 (35%)
IG_like 165..246 CDD:214653 23/106 (22%)
Ig 175..241 CDD:143165 22/91 (24%)
Ig_3 255..318 CDD:290638 4/62 (6%)
IG_like 347..429 CDD:214653 24/74 (32%)
Ig 351..426 CDD:143165 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.