DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and dpr9

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:202 Identity:46/202 - (22%)
Similarity:73/202 - (36%) Gaps:61/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRDAMVNCFVEGMPAP----EVSWLYN--------GEYINTVNSTKHNRLSNG-------LYIRN 211
            |:.|.:||.|:.:...    :|||:.:        |.|  |..|.:..|..:.       |.|:.
  Fly   271 GKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRY--TYTSDQRFRAIHQPQTEDWMLQIKY 333

  Fly   212 VSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETL---------PVQYAYVGGAVN 267
            ....|:|.|.|: :..||               |..|:.....:         |..|...|..:|
  Fly   334 PQHRDSGIYECQ-VSTTP---------------HMSHYIHLNVV
EPSTEIIGAPDLYIESGSTIN 382

  Fly   268 LSCDAMGEP-PPSFT-WLHNN-----KGIVGFNHR----IFVADYGAT----LQLQMKNASQFGD 317
            |:|.....| ||::. |.|||     ..|:.::..    ..|.:.|.|    |.::....|..|.
  Fly   383 LTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGH 447

  Fly   318 YKCKVAN 324
            |:|..:|
  Fly   448 YQCNPSN 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/76 (25%)
IG_like 256..336 CDD:214653 23/84 (27%)
IGc2 263..327 CDD:197706 21/77 (27%)
FN3 341..445 CDD:238020
dpr9NP_001287332.1 Ig 263..361 CDD:299845 23/107 (21%)
IG_like 263..360 CDD:214653 23/106 (22%)
IG_like 371..464 CDD:214653 23/84 (27%)
IGc2 377..456 CDD:197706 21/78 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.