DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Cntn4

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001103219.1 Gene:Cntn4 / 269784 MGIID:1095737 Length:1026 Species:Mus musculus


Alignment Length:460 Identity:106/460 - (23%)
Similarity:159/460 - (34%) Gaps:97/460 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PPTPPLSLQPST-----PSITHFVNESFIIFCQTVQKDIDTK----------------WRDPRGQ 86
            ||||.:......     |.|.       :.|.:||..:..|.                ||...|:
Mouse   208 PPTPLILRNDGVMGEYEPKIE-------VQFPETVPAEKGTTVKLECFALGNPVPTILWRRADGK 265

  Fly    87 TRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQK 151
            .... |.|.|   |:.|:|.:  .:...||.|::.|....:|..|              :...|.
Mouse   266 PIAR-KARRH---KSNGILEI--PNFQQEDAGSYECVAENSRGKN--------------VAKGQL 310

  Fly   152 ISFGKTEQVQSVREGRDAMV-----NCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNGLYIRN 211
            ..:.:...||.:.:...||.     .|...|.|.|...||.||:.:.|.:..:..:.:..:.|.|
Mouse   311 TFYAQPNWVQIINDIHVAMEESVFWECKANGRPKPTYRWLKNGDPLLTRDRIQIEQGTLNITIVN 375

  Fly   212 VSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETL--PVQYAYVGGAVNLSCDAMG 274
            :|  |||.|.|.|.........|.::::   |...|.  |:.||  .|....|||.|.:.|....
Mouse   376 LS--DAGMYQCVAENKHGVIFSSAELSV---IAESPD--FSRTLLKRVTLVKVGGEVVIECKPKA 433

  Fly   275 EPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKVANPLGMLE---RVIKLR 336
            .|.|.:|| ...:.|:..|.||.:::.| .|::.....|..|.|.|...|..|...   .||...
Mouse   434 SPRPVYTW-RKGREILRENERITISEDG-NLRIINVTKSDAGSYTCIATNHFGTASSTGNVIVKD 496

  Fly   337 PGPKPLGPRRFQ--------LKKLYTNGFELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAG 393
            |....:.|....        |....|:...|||......|        |:.:.:..|.:.....|
Mouse   497 PTKVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWTFN--------GHLIDFDKDGDHFERVG 553

  Fly   394 NWSYAKQ---RDFSF-HGGKHFIIPHLETNTTYLMRAASRNLAGLSDWSPVKVFT------TAAG 448
            ....|..   |:... |.||:..:  ::|:...|..||...:.|..  .|.:..|      |.|.
Mouse   554 GQDSAGDLMIRNIQLKHAGKYVCM--VQTSVDKLSVAADLIVRGPP--GPPEAVTIDEITDTTAQ 614

  Fly   449 CSWSP 453
            .||.|
Mouse   615 LSWRP 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 15/67 (22%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 23/90 (26%)
Ig strand B 169..173 CDD:409353 2/8 (25%)
Ig strand C 182..186 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 0/3 (0%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 24/82 (29%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 22/121 (18%)
Cntn4NP_001103219.1 Ig 25..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..213 CDD:472250 4/4 (100%)
Ig strand B 140..144 CDD:409353
Ig strand C 154..158 CDD:409353
Ig strand E 177..181 CDD:409353
Ig strand F 191..196 CDD:409353
Ig strand G 207..210 CDD:409353 1/1 (100%)
Ig 225..313 CDD:472250 22/114 (19%)
Ig strand B 243..247 CDD:409353 0/3 (0%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 2/3 (67%)
Ig strand F 292..297 CDD:409353 1/4 (25%)
Ig strand G 305..308 CDD:409353 0/2 (0%)
Ig 318..401 CDD:472250 23/84 (27%)
Ig strand B 333..337 CDD:409353 0/3 (0%)
Ig strand C 346..350 CDD:409353 0/3 (0%)
Ig strand E 367..371 CDD:409353 0/3 (0%)
Ig strand F 381..386 CDD:409353 2/4 (50%)
Ig strand G 394..397 CDD:409353 0/2 (0%)
Ig 406..494 CDD:472250 27/91 (30%)
Ig strand B 425..429 CDD:409353 1/3 (33%)
Ig strand C 438..442 CDD:409353 2/4 (50%)
Ig strand E 460..464 CDD:409353 2/4 (50%)
Ig strand F 474..479 CDD:409353 2/4 (50%)
Ig strand G 487..490 CDD:409353 0/2 (0%)
Ig6_Contactin-4 496..597 CDD:409439 21/110 (19%)
Ig strand A 496..502 CDD:409439 1/5 (20%)
Ig strand A' 505..510 CDD:409439 0/4 (0%)
Ig strand B 513..521 CDD:409439 1/7 (14%)
Ig strand C 530..534 CDD:409439 0/3 (0%)
Ig strand D 555..558 CDD:409439 0/2 (0%)
Ig strand E 559..563 CDD:409439 0/3 (0%)
Ig strand F 572..579 CDD:409439 2/8 (25%)
FN3 580..>1014 CDD:442628 12/42 (29%)
Ig strand G 586..590 CDD:409439 1/3 (33%)
FN3 597..690 CDD:238020 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..906
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.