DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and DIP-lambda

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:436 Identity:89/436 - (20%)
Similarity:150/436 - (34%) Gaps:106/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DPRGQTREN--TKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVN----GNRNGNRNVNVEREF 140
            :||.....|  ...::||.:            :.:.|.|::.|:||    .:.:|..:|.|..:.
  Fly   102 NPRLSVTHNGHNTWKLHISR------------VQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDI 154

  Fly   141 LASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSW----------LYNGEYINTV 195
            |...|          ...:....:||....:.|.|.|:|.|:|.|          ..:|......
  Fly   155 LNHPE----------HNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGF 209

  Fly   196 NSTKHNRLSNGLYIRNVSQADAGEYTCRAMR-ITPTFSDSDQITILLRIQHKPHWFFNETLPVQY 259
            .|.:..|    |.:.||.::|.|.|.|.|.. |.|:.|....:.:          .|:.|:....
  Fly   210 KSVEGER----LVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYV----------NFSPTVKAIS 260

  Fly   260 AYVGG----AVNLSCDAMGEPPPSFTW--------LHNNKGIVGFNHRIFVADYGATLQLQMKNA 312
            ..||.    .|.|.|.....|.|...|        |||..........|.:..:...|.::....
  Fly   261 QLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYTWHLNLTIRHLTK 325

  Fly   313 SQFGDYKCKVANPLGMLERVIKLR-------------PGPKPLGPRRFQLKKLYTNGFE--LDIQ 362
            |.||.|.|...|.||..|.:|:|:             |..:..|..|.:....:..|..  |..|
  Fly   326 SDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHPASHKKGLNEVLRFQ 390

  Fly   363 TPRMSN-VSDEMQIY--GYRVAYMSDTE---FKFSAGNW-SYAKQRDFSFHGGKHF--------- 411
            ....:| :..|.:.:  |:.:...:::|   ....:|:. |...:.|.:.:..|.:         
  Fly   391 ETHFANQIQQENEDHNEGFDLLKFTNSENSNIVLESGHINSMINKEDVNIYHPKQYGQEKTNKPS 455

  Fly   412 -IIPHLETNTTYLMRAASRNLAGLSDWSPVKVFTTAAGCSWSPWLY 456
             .||  .|.|.:::..|......|:.::.|.:.|       |.||:
  Fly   456 GTIP--STRTPWILTNAGSQRPALTSYATVALIT-------SFWLF 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/68 (28%)
IG_like 256..336 CDD:214653 23/91 (25%)
IGc2 263..327 CDD:197706 18/75 (24%)
FN3 341..445 CDD:238020 20/122 (16%)
DIP-lambdaNP_001334747.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.