DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and NEGR1

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:296 Identity:68/296 - (22%)
Similarity:107/296 - (36%) Gaps:70/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
            ::|.|.|||..      ..||. ||          ||.|........:|..:::.:.|.|.:||.
Human    71 WLNRSSIIFAG------GDKWSVDP----------RVSISTLNKRDYSLQIQNVDVTDDGPYTCS 119

  Fly   124 VNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLY- 187
            |. .::..|.:.|        .|.|.............:|.||.:..:.|...|.|.|.:||.: 
Human   120 VQ-TQHTPRTMQV--------HLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHI 175

  Fly   188 --------NGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQ 244
                    ||:|::               |..:::..||||.|.|.. ..:|.|..::.:::.. 
Human   176 SPSAKPFENGQYLD---------------IYGITRDQAGEYECSAEN-DVSFPDVRKVKVVVNF- 223

  Fly   245 HKPHWFFNETLPVQYAYVGGAVN------LSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGA 303
                      .|.......|.|.      :.|:..|.|||:|.|....|.:......|.:.::..
Human   224 ----------APTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFST 278

  Fly   304 TLQLQMKNASQ--FGDYKCKVANPLGMLERVIKLRP 337
            ...|.:.|.:|  ||:|.|..||.||.....:.|.|
Human   279 RSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/67 (25%)
IG_like 256..336 CDD:214653 23/87 (26%)
IGc2 263..327 CDD:197706 20/71 (28%)
FN3 341..445 CDD:238020
NEGR1NP_776169.2 IG 47..135 CDD:214652 21/88 (24%)
IGc2 152..210 CDD:197706 18/73 (25%)
Ig_3 225..301 CDD:372822 19/75 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143447
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.