Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028483.2 | Gene: | Vsig10 / 231668 | MGIID: | 2448533 | Length: | 558 | Species: | Mus musculus |
Alignment Length: | 314 | Identity: | 73/314 - (23%) |
---|---|---|---|
Similarity: | 104/314 - (33%) | Gaps: | 100/314 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 ALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAM 170
Fly 171 V--NCFVEGMPAPEVSWLYNGEYINTVNSTK---HNRLSNGLYIRNVSQADAGEYTCRAMRI--- 227
Fly 228 -----------------TPTFS---DSDQITILLRIQ-----HKPHWFFNE-------------T 254
Fly 255 L---------------------------------------PVQYAYVGGAVNLSCDAMG-EPPPS 279
Fly 280 FTWLHN--NKGIVGFNHRIFVADYGATLQLQMKNASQ---FGDYKCKVANPLGM 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 19/63 (30%) |
IG_like | 256..336 | CDD:214653 | 26/79 (33%) | ||
IGc2 | 263..327 | CDD:197706 | 23/69 (33%) | ||
FN3 | 341..445 | CDD:238020 | |||
Vsig10 | NP_001028483.2 | Ig | 47..135 | CDD:299845 | 11/26 (42%) |
IG_like | 55..140 | CDD:214653 | 12/34 (35%) | ||
IG_like | 160..240 | CDD:214653 | 20/84 (24%) | ||
Ig | <184..238 | CDD:299845 | 13/58 (22%) | ||
IG_like | 341..421 | CDD:214653 | 25/73 (34%) | ||
Ig | 345..418 | CDD:143165 | 22/69 (32%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 477..515 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 532..558 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12231 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |