| Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001028483.2 | Gene: | Vsig10 / 231668 | MGIID: | 2448533 | Length: | 558 | Species: | Mus musculus |
| Alignment Length: | 314 | Identity: | 73/314 - (23%) |
|---|---|---|---|
| Similarity: | 104/314 - (33%) | Gaps: | 100/314 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 106 ALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAM 170
Fly 171 V--NCFVEGMPAPEVSWLYNGEYINTVNSTK---HNRLSNGLYIRNVSQADAGEYTCRAMRI--- 227
Fly 228 -----------------TPTFS---DSDQITILLRIQ-----HKPHWFFNE-------------T 254
Fly 255 L---------------------------------------PVQYAYVGGAVNLSCDAMG-EPPPS 279
Fly 280 FTWLHN--NKGIVGFNHRIFVADYGATLQLQMKNASQ---FGDYKCKVANPLGM 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG33543 | NP_001014458.3 | Ig | <71..>123 | CDD:472250 | 9/16 (56%) |
| Ig strand E | 105..109 | CDD:409353 | 2/2 (100%) | ||
| Ig strand F | 119..123 | CDD:409353 | 2/3 (67%) | ||
| Ig | 153..239 | CDD:472250 | 25/113 (22%) | ||
| Ig strand B | 169..173 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C | 182..186 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 205..209 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 219..224 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 232..235 | CDD:409353 | 1/5 (20%) | ||
| IG_like | 256..336 | CDD:214653 | 26/79 (33%) | ||
| Ig strand B | 266..270 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 279..283 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 302..309 | CDD:409353 | 2/6 (33%) | ||
| Ig strand F | 317..322 | CDD:409353 | 2/4 (50%) | ||
| FN3 | 341..445 | CDD:238020 | |||
| Vsig10 | NP_001028483.2 | IG_like | 55..140 | CDD:214653 | 12/34 (35%) |
| Ig strand B | 61..65 | CDD:409353 | |||
| Ig strand C | 74..78 | CDD:409353 | |||
| Ig strand E | 107..111 | CDD:409353 | 2/2 (100%) | ||
| Ig strand F | 121..125 | CDD:409353 | 2/3 (67%) | ||
| IG_like | 160..240 | CDD:214653 | 20/84 (24%) | ||
| Ig strand B | 170..174 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 183..187 | CDD:409353 | 3/8 (38%) | ||
| Ig strand E | 208..212 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 218..223 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 232..235 | CDD:409353 | 0/2 (0%) | ||
| IG_like | 341..421 | CDD:214653 | 25/73 (34%) | ||
| Ig strand B | 345..349 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 359..363 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 386..390 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 401..406 | CDD:409353 | 2/4 (50%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 477..515 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 532..558 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||