DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Vsig10

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001028483.2 Gene:Vsig10 / 231668 MGIID:2448533 Length:558 Species:Mus musculus


Alignment Length:314 Identity:73/314 - (23%)
Similarity:104/314 - (33%) Gaps:100/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAM 170
            ||..|.:.|||.||:||:...|......|.:.   :||....|...||...|....::...|.:.
Mouse   108 ALRIEALRLEDDGNYTCQEVLNETHWFPVRLR---V
ASGPAYVEVNISATGTLPNGTLYAARGSQ 169

  Fly   171 V--NCFVEGMPAPEVSWLYNGEYINTVNSTK---HNRLSNGLYIRNVSQADAGEYTCRAMRI--- 227
            |  ||.....|.|||.|     :|.|.:..:   .|..:|...:..:||...|.|||.|..:   
Mouse   170 VDFNCCSAAQPPPEVEW-----WIQTHSIPEFLGKNLSANSFTLMLMSQNLQGNYTCSATNVLSG 229

  Fly   228 -----------------TPTFS---DSDQITILLRIQ-----HKPHWFFNE-------------T 254
                             .|..|   .|:..|:.|...     ..|.:.:.|             |
Mouse   230 RQRKVTTELLVYWPPPSAPQCSVEVSSESTTLELACNWDGGYPDPTFLWTEEPGGTIMGNSKLQT 294

  Fly   255 L---------------------------------------PVQYAYVGGAVNLSCDAMG-EPPPS 279
            |                                       |::..:|||.|.|:|:..| .||..
Mouse   295 LSPAQLLEGKKFKCVGNHILGPESGASCVVKLSSPLLPSQPMRTCFVGGNVTLTCEVSGANPPAR 359

  Fly   280 FTWLHN--NKGIVGFNHRIFVADYGATLQLQMKNASQ---FGDYKCKVANPLGM 328
            ..||.|  ...|...:|.| :...|.:..|.:.|.||   .|.|.|:..|.:|:
Mouse   360 IQWLRNLTQPAIQPSSHYI-ITQQGQSSSLTIHNCSQDLDEGFYYCQAENLVGV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 9/16 (56%)
Ig strand E 105..109 CDD:409353 2/2 (100%)
Ig strand F 119..123 CDD:409353 2/3 (67%)
Ig 153..239 CDD:472250 25/113 (22%)
Ig strand B 169..173 CDD:409353 1/5 (20%)
Ig strand C 182..186 CDD:409353 2/3 (67%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 1/5 (20%)
IG_like 256..336 CDD:214653 26/79 (33%)
Ig strand B 266..270 CDD:409353 2/3 (67%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020
Vsig10NP_001028483.2 IG_like 55..140 CDD:214653 12/34 (35%)
Ig strand B 61..65 CDD:409353
Ig strand C 74..78 CDD:409353
Ig strand E 107..111 CDD:409353 2/2 (100%)
Ig strand F 121..125 CDD:409353 2/3 (67%)
IG_like 160..240 CDD:214653 20/84 (24%)
Ig strand B 170..174 CDD:409353 1/3 (33%)
Ig strand C 183..187 CDD:409353 3/8 (38%)
Ig strand E 208..212 CDD:409353 0/3 (0%)
Ig strand F 218..223 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 341..421 CDD:214653 25/73 (34%)
Ig strand B 345..349 CDD:409353 2/3 (67%)
Ig strand C 359..363 CDD:409353 0/3 (0%)
Ig strand E 386..390 CDD:409353 1/3 (33%)
Ig strand F 401..406 CDD:409353 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..515
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..558
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.