DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Iglon5

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:307 Identity:68/307 - (22%)
Similarity:115/307 - (37%) Gaps:71/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEV 124
            ::|.|.|::.               |..|..:..||.:...|....:::...:.|.|.|.:||..
Mouse    65 WLNRSNILYA---------------GNDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSF 114

  Fly   125 NGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNG 189
            ...         .:.:.....|:|:............:|.||.:..:.|...|.|.|.|:|    
Mouse   115 QTR---------HQPYTTQVYLIVHVPARIVNISSPVAVNEGGNVNLLCLAVGRPEPTVTW---- 166

  Fly   190 EYINTVNSTKHNRLSNG--LYIRNVSQADAGEYTCRAMRITPTFSDS--DQITILLRIQHKPHWF 250
                  ...:....|.|  |.|.::.:..||||.|    :|....:|  |...:|:.:.:.|  .
Mouse   167 ------RQLRDGFTSEGEILEISDIQRGQAGEYEC----VTHNGVNSAPDSRRVLVTVNYPP--T 219

  Fly   251 FNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMK----- 310
            ..:....:.| :|.|..|.|:||..||..|.|..::        |:..:.....|::|.:     
Mouse   220 ITDVTSARTA-LGRAALLRCEAMAVPPADFQWYKDD--------RLLSSGSAEGLKVQTERTRSM 275

  Fly   311 ------NASQFGDYKCKVANPLGMLERVIK-LRPG------PKPLGP 344
                  :|..:|:|.|:.||.||.....:: ||||      |:|.||
Mouse   276 LLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/60 (28%)
IG_like 256..336 CDD:214653 22/91 (24%)
IGc2 263..327 CDD:197706 19/74 (26%)
FN3 341..445 CDD:238020 3/4 (75%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 14/87 (16%)
Ig strand A' 41..46 CDD:409353
Ig strand B 48..56 CDD:409353
CDR1 56..60 CDD:409353
FR2 61..68 CDD:409353 0/2 (0%)
Ig strand C 61..67 CDD:409353 0/1 (0%)
CDR2 69..79 CDD:409353 3/24 (13%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 8/34 (24%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 0/12 (0%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 0/4 (0%)
Ig_3 134..199 CDD:404760 19/78 (24%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 1/8 (13%)
Ig strand C 163..167 CDD:409353 2/13 (15%)
Ig strand D 174..177 CDD:409353 1/2 (50%)
Ig strand E 178..183 CDD:409353 1/4 (25%)
Ig strand F 191..199 CDD:409353 5/11 (45%)
Ig_3 217..295 CDD:404760 19/88 (22%)
putative Ig strand A 218..224 CDD:409353 1/7 (14%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833605
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.