DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and rig-3

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:446 Identity:98/446 - (21%)
Similarity:153/446 - (34%) Gaps:106/446 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TPSITHFVNESFIIFC-----QTVQKDIDTKWRDPRGQTRE------------NTKGRVHIEKKT 101
            |.:||....:..::.|     :.:.|. |..|:...|...:            |.||..|  :||
 Worm    46 TNTITVREGKKLMVSCVFESDEQIHKS-DLLWKQANGNNIDGESNPSLFSVILNEKGSKH--RKT 107

  Fly   102 TGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREG 166
                :|.|..:...|.|.:||  .|...|..|      |..:.:|:|...|.:...:.|:....|
 Worm   108 ----SLHFSSVHTRDTGLYTC--TGRTAGGEN------FEKTIKLVVLPAIEWNDKDTVKGALLG 160

  Fly   167 RDAMVNCFVE---------------GMPAPEVSWLYNGEYINTVNSTK--HNRLSNGLYIRNVSQ 214
            ....::|.|:               |.|..|..|...|... |::|.|  |..|:.......:.|
 Worm   161 EPITIDCGVKGPSGKEPMIQMTNGNGEPLDEEIWTIAGNEA-TIDSLKKEHAELTVSCITIEMHQ 224

  Fly   215 ADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVN---LSCDAMGEP 276
            ..:.|          .|...|:..:.:.:...|.:...|:  |||..:...|.   :.|:.....
 Worm   225 ETSKE----------EFPVVDRKDVNIEVYTLPEFETEES--VQYTVIDNHVRDAIIYCNVTHSF 277

  Fly   277 PP--SFTWLHNNKGI-VGFNHRIFV---ADYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKL 335
            ||  .:|:.|.::.| :.....|||   ...||.|::...|.:..|.|||:..|........|.|
 Worm   278 PPVRHYTFYHGDEEIKMSDKFNIFVNVGVSQGAHLKIHNVNENDLGTYKCEANNIKAKSYHTIHL 342

  Fly   336 RPGPKPLGP--------RRFQLKKLYTNGFELDIQ------------TPRMSNVSDEMQIYGYRV 380
            |....|..|        |...:.|:.:...:.|:.            |...|.||||        
 Worm   343 REANAPAEPKVTLIEDKRHSIIWKVESIDRDPDLPMTAVEIRHLRAGTAEASGVSDE-------- 399

  Fly   381 AYMSDTEFKFSAGNWSYAKQRDFSFHGGKHFIIPHLETNTTYLMRAASRNLAGLSD 436
             .:||..:|    :.|...||:....|  .:.|..|.....|:.|....|.||..|
 Worm   400 -DISDAYWK----SHSIFMQRNIKDDG--IYEINGLRHGHEYVWRFRQINEAGFGD 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 15/75 (20%)
IG_like 256..336 CDD:214653 23/88 (26%)
IGc2 263..327 CDD:197706 19/72 (26%)
FN3 341..445 CDD:238020 26/116 (22%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653 24/108 (22%)
Ig 267..341 CDD:319273 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.