DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Ncam2

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:576 Identity:117/576 - (20%)
Similarity:196/576 - (34%) Gaps:212/576 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLA-LVFEHIALEDRGNWTCEV 124
            |.||....|..:.:.....|.:|:|:...:|: ||.::|:  |:.: |...:..:||.|.:.|:.
Mouse    34 VGESKFFTCTAIGEPESIDWYNPQGEKIISTQ-RVMLQKE--GVRSRLTIYNANIEDAGIYRCQA 95

  Fly   125 NGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNG 189
            ...:...:...|..|        :.||::|.:....|..::|.||.|.|.|...|||.|||||:.
Mouse    96 TDAKGQTQEATVVLE--------IYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHN 152

  Fly   190 EYINTVNSTKHNRL-SNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQ---HKPHWF 250
            |.:.|:...:...| :|.|.|.|::::|.|.|.|..........|...|.:::.:.   ..|...
Mouse   153 EEVTTIPDNRFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAIMMPQKS 217

  Fly   251 FNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNA--S 313
            ||.|     |..|..:.|:|.|.|.|.|:.:|..|.| ::..|.:..:.  |:..:|.::|.  .
Mouse   218 FNAT-----AERGEEMTLTCKASGSPDPTISWFRNGK-LIEENEKYILK--GSNTELTVRNIINK 274

  Fly   314 QFGDYKCKVANPLG-----------MLERVIKLR-------------------PGPKPLGPR--- 345
            ..|.|.||..|..|           :...:::|:                   |.|:....|   
Mouse   275 DGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKRAID 339

  Fly   346 -------------RFQLK-------------KLYTNG----------------FELDIQ-TPRMS 367
                         |.::|             ||..:|                ..|||: .|:. 
Mouse   340 GVMFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAPKF- 403

  Fly   368 NVSDEMQIYGY-----------------------------------------------RVAYMSD 385
             ||::...|.:                                               .:|..||
Mouse   404 -VSNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKMILEIAPTSD 467

  Fly   386 TEF---KFSAGNWSYAKQRDF--------------------------SF-----HGG---KHF-- 411
            .:|   ..:|.|....:.:::                          ||     |||   .|:  
Mouse   468 NDFGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFNKPESHGGVPIHHYQV 532

  Fly   412 ----------------------IIPHLETNTTYLMRAASRNLAGLSDWSPVKVFTT 445
                                  ::..||.||||.:|.|:.|..|..|:|.:::|.|
Mouse   533 DVKEVASETWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKGQGDYSKIEIFQT 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 12/52 (23%)
Ig strand E 105..109 CDD:409353 1/4 (25%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 29/86 (34%)
Ig strand B 169..173 CDD:409353 2/3 (67%)
Ig strand C 182..186 CDD:409353 2/3 (67%)
Ig strand E 205..209 CDD:409353 2/3 (67%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 21/92 (23%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 38/257 (15%)
Ncam2NP_001106679.1 IgI_1_NCAM-2 21..113 CDD:409452 19/89 (21%)
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452 3/9 (33%)
Ig strand C 49..55 CDD:409452 1/5 (20%)
Ig strand C' 58..60 CDD:409452 1/1 (100%)
Ig strand D 66..72 CDD:409452 2/5 (40%)
Ig strand E 74..82 CDD:409452 1/7 (14%)
Ig strand F 89..96 CDD:409452 2/6 (33%)
Ig strand G 101..112 CDD:409452 2/18 (11%)
IG_like 122..187 CDD:214653 25/64 (39%)
Ig strand B 132..136 CDD:409353 2/3 (67%)
Ig strand C 145..152 CDD:409353 5/6 (83%)
Ig strand E 169..173 CDD:409353 2/3 (67%)
Ig strand F 183..187 CDD:409353 1/3 (33%)
Ig strand G 191..194 CDD:409353 0/2 (0%)
IgI_1_MuSK 209..298 CDD:409562 25/96 (26%)
Ig strand A 209..212 CDD:409562 0/2 (0%)
Ig strand A' 217..222 CDD:409562 3/9 (33%)
Ig strand B 228..235 CDD:409562 2/6 (33%)
Ig strand C 241..246 CDD:409562 1/4 (25%)
Ig strand C' 248..250 CDD:409562 1/2 (50%)
Ig strand D 257..260 CDD:409562 0/2 (0%)
Ig strand E 264..270 CDD:409562 1/5 (20%)
Ig strand F 277..284 CDD:409562 4/6 (67%)
Ig strand G 290..298 CDD:409562 0/7 (0%)
Ig 300..397 CDD:472250 10/96 (10%)
Ig strand B 318..322 CDD:409353 0/3 (0%)
Ig strand C 331..335 CDD:409353 0/3 (0%)
Ig strand E 363..367 CDD:409353 0/3 (0%)
Ig strand F 377..382 CDD:409353 0/4 (0%)
Ig strand G 390..393 CDD:409353 0/2 (0%)
Ig_3 401..479 CDD:464046 9/79 (11%)
FN3 496..588 CDD:238020 19/91 (21%)
fn3 594..678 CDD:394996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.