| Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001106679.1 | Gene: | Ncam2 / 17968 | MGIID: | 97282 | Length: | 837 | Species: | Mus musculus |
| Alignment Length: | 576 | Identity: | 117/576 - (20%) |
|---|---|---|---|
| Similarity: | 196/576 - (34%) | Gaps: | 212/576 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 61 VNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLA-LVFEHIALEDRGNWTCEV 124
Fly 125 NGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNG 189
Fly 190 EYINTVNSTKHNRL-SNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQ---HKPHWF 250
Fly 251 FNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNA--S 313
Fly 314 QFGDYKCKVANPLG-----------MLERVIKLR-------------------PGPKPLGPR--- 345
Fly 346 -------------RFQLK-------------KLYTNG----------------FELDIQ-TPRMS 367
Fly 368 NVSDEMQIYGY-----------------------------------------------RVAYMSD 385
Fly 386 TEF---KFSAGNWSYAKQRDF--------------------------SF-----HGG---KHF-- 411
Fly 412 ----------------------IIPHLETNTTYLMRAASRNLAGLSDWSPVKVFTT 445 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG33543 | NP_001014458.3 | Ig | <71..>123 | CDD:472250 | 12/52 (23%) |
| Ig strand E | 105..109 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 119..123 | CDD:409353 | 0/3 (0%) | ||
| Ig | 153..239 | CDD:472250 | 29/86 (34%) | ||
| Ig strand B | 169..173 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 182..186 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 205..209 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 219..224 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 232..235 | CDD:409353 | 1/2 (50%) | ||
| IG_like | 256..336 | CDD:214653 | 21/92 (23%) | ||
| Ig strand B | 266..270 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 279..283 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 302..309 | CDD:409353 | 2/6 (33%) | ||
| Ig strand F | 317..322 | CDD:409353 | 2/4 (50%) | ||
| FN3 | 341..445 | CDD:238020 | 38/257 (15%) | ||
| Ncam2 | NP_001106679.1 | IgI_1_NCAM-2 | 21..113 | CDD:409452 | 19/89 (21%) |
| Ig strand A | 21..26 | CDD:409452 | |||
| Ig strand A' | 29..33 | CDD:409452 | |||
| Ig strand B | 35..45 | CDD:409452 | 3/9 (33%) | ||
| Ig strand C | 49..55 | CDD:409452 | 1/5 (20%) | ||
| Ig strand C' | 58..60 | CDD:409452 | 1/1 (100%) | ||
| Ig strand D | 66..72 | CDD:409452 | 2/5 (40%) | ||
| Ig strand E | 74..82 | CDD:409452 | 1/7 (14%) | ||
| Ig strand F | 89..96 | CDD:409452 | 2/6 (33%) | ||
| Ig strand G | 101..112 | CDD:409452 | 2/18 (11%) | ||
| IG_like | 122..187 | CDD:214653 | 25/64 (39%) | ||
| Ig strand B | 132..136 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 145..152 | CDD:409353 | 5/6 (83%) | ||
| Ig strand E | 169..173 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 183..187 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 191..194 | CDD:409353 | 0/2 (0%) | ||
| IgI_1_MuSK | 209..298 | CDD:409562 | 25/96 (26%) | ||
| Ig strand A | 209..212 | CDD:409562 | 0/2 (0%) | ||
| Ig strand A' | 217..222 | CDD:409562 | 3/9 (33%) | ||
| Ig strand B | 228..235 | CDD:409562 | 2/6 (33%) | ||
| Ig strand C | 241..246 | CDD:409562 | 1/4 (25%) | ||
| Ig strand C' | 248..250 | CDD:409562 | 1/2 (50%) | ||
| Ig strand D | 257..260 | CDD:409562 | 0/2 (0%) | ||
| Ig strand E | 264..270 | CDD:409562 | 1/5 (20%) | ||
| Ig strand F | 277..284 | CDD:409562 | 4/6 (67%) | ||
| Ig strand G | 290..298 | CDD:409562 | 0/7 (0%) | ||
| Ig | 300..397 | CDD:472250 | 10/96 (10%) | ||
| Ig strand B | 318..322 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 331..335 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 363..367 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 377..382 | CDD:409353 | 0/4 (0%) | ||
| Ig strand G | 390..393 | CDD:409353 | 0/2 (0%) | ||
| Ig_3 | 401..479 | CDD:464046 | 9/79 (11%) | ||
| FN3 | 496..588 | CDD:238020 | 19/91 (21%) | ||
| fn3 | 594..678 | CDD:394996 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 764..810 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||