| Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510118.1 | Gene: | Ncam1 / 17967 | MGIID: | 97281 | Length: | 1162 | Species: | Mus musculus |
| Alignment Length: | 308 | Identity: | 76/308 - (24%) |
|---|---|---|---|
| Similarity: | 125/308 - (40%) | Gaps: | 30/308 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 48 LSLQ----PSTPSITHFVNESFIIFCQTV--QKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLA 106
Fly 107 LVFEHIALEDRGNWTCEVNGNRNGNRN---VNVEREFLASFELLVNQKISFGKTEQVQSVREGRD 168
Fly 169 AMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNG-LYIRNVSQADAGEYTCRAMRITPTFS 232
Fly 233 DSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNH--- 294
Fly 295 -RIFVADYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGPKP 341 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG33543 | NP_001014458.3 | Ig | <71..>123 | CDD:472250 | 10/53 (19%) |
| Ig strand E | 105..109 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 119..123 | CDD:409353 | 0/3 (0%) | ||
| Ig | 153..239 | CDD:472250 | 22/86 (26%) | ||
| Ig strand B | 169..173 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 182..186 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 205..209 | CDD:409353 | 2/4 (50%) | ||
| Ig strand F | 219..224 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 232..235 | CDD:409353 | 0/2 (0%) | ||
| IG_like | 256..336 | CDD:214653 | 21/83 (25%) | ||
| Ig strand B | 266..270 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 279..283 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 302..309 | CDD:409353 | 1/6 (17%) | ||
| Ig strand F | 317..322 | CDD:409353 | 2/4 (50%) | ||
| FN3 | 341..445 | CDD:238020 | 1/1 (100%) | ||
| Ncam1 | XP_006510118.1 | IgI_1_NCAM-1 | 20..116 | CDD:409451 | 26/108 (24%) |
| Ig strand A | 20..25 | CDD:409451 | 2/4 (50%) | ||
| Ig strand A' | 28..32 | CDD:409451 | 0/3 (0%) | ||
| Ig strand B | 34..44 | CDD:409451 | 4/9 (44%) | ||
| Ig strand C | 50..56 | CDD:409451 | 2/5 (40%) | ||
| Ig strand C' | 59..61 | CDD:409451 | 1/1 (100%) | ||
| Ig strand D | 69..75 | CDD:409451 | 0/5 (0%) | ||
| Ig strand E | 77..85 | CDD:409451 | 1/7 (14%) | ||
| Ig strand F | 92..100 | CDD:409451 | 3/7 (43%) | ||
| Ig strand G | 104..115 | CDD:409451 | 3/20 (15%) | ||
| IG_like | 124..190 | CDD:214653 | 19/65 (29%) | ||
| Ig strand B | 135..139 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 148..152 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 172..176 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 186..191 | CDD:409353 | 2/4 (50%) | ||
| IgI_3_NCAM-1 | 211..308 | CDD:143207 | 23/97 (24%) | ||
| Ig strand A | 211..216 | CDD:143207 | 1/4 (25%) | ||
| Ig strand A' | 220..226 | CDD:143207 | 0/5 (0%) | ||
| Ig strand B | 229..239 | CDD:143207 | 5/9 (56%) | ||
| Ig strand C | 243..249 | CDD:143207 | 2/5 (40%) | ||
| Ig strand C' | 251..253 | CDD:143207 | 0/1 (0%) | ||
| Ig strand D | 263..266 | CDD:143207 | 0/2 (0%) | ||
| Ig strand E | 271..277 | CDD:143207 | 1/5 (20%) | ||
| Ig strand F | 283..292 | CDD:143207 | 2/8 (25%) | ||
| Ig strand G | 295..307 | CDD:143207 | 3/11 (27%) | ||
| IgI_NCAM-1 | 307..413 | CDD:143277 | 2/3 (67%) | ||
| Ig strand A | 307..312 | CDD:143277 | 2/3 (67%) | ||
| Ig strand A' | 316..320 | CDD:143277 | |||
| Ig strand B | 325..333 | CDD:143277 | |||
| Ig strand C | 339..345 | CDD:143277 | |||
| Ig strand C' | 348..351 | CDD:143277 | |||
| Ig strand D | 369..375 | CDD:143277 | |||
| Ig strand E | 378..384 | CDD:143277 | |||
| Ig strand F | 392..400 | CDD:143277 | |||
| Ig strand G | 403..413 | CDD:143277 | |||
| IG_like | 422..500 | CDD:214653 | |||
| Ig strand B | 433..437 | CDD:409353 | |||
| Ig strand C | 446..450 | CDD:409353 | |||
| Ig strand E | 473..477 | CDD:409353 | |||
| Ig strand F | 487..492 | CDD:409353 | |||
| fn3 | 512..599 | CDD:394996 | |||
| fn3 | 649..731 | CDD:394996 | |||
| PHA03247 | <905..1140 | CDD:223021 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||