DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Ncam1

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:308 Identity:76/308 - (24%)
Similarity:125/308 - (40%) Gaps:30/308 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LSLQ----PSTPSITHFVNESFIIFCQTV--QKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLA 106
            :|||    ||...|:  |.||....||..  .||.|..|..|.|:.....:.|:.:.........
Mouse    18 VSLQVDIVPSQGEIS--VGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSST 80

  Fly   107 LVFEHIALEDRGNWTCEVNGNRNGNRN---VNVEREFLASFELLVNQKISFGKTEQVQSVREGRD 168
            |...:..::|.|.:.|.|.. .:|.::   |||:          :.||:.|......|..:||.|
Mouse    81 LTIYNANIDDAGIYKCVVTA-EDGTQSEATVNVK----------IFQKLMFKNAPTPQEFKEGED 134

  Fly   169 AMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNG-LYIRNVSQADAGEYTCRAMRITPTFS 232
            |::.|.|.....|.:.|.:.|..:......:...|||. |.||.:.:.|.|.|.|....:.....
Mouse   135 AVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEI 199

  Fly   233 DSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNH--- 294
            :...|.:::.:  .|.....:::....|.:|.:|.|.|||.|.|.|:.:|..:.:.|.....   
Mouse   200 NFKDIQVIVNV--PPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDE 262

  Fly   295 -RIFVADYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGPKP 341
             .|| :|..:.|.::..:.:...:|.|...|..|..:..|.|:...||
Mouse   263 KHIF-SDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 10/53 (19%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 22/86 (26%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 182..186 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 2/4 (50%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 21/83 (25%)
Ig strand B 266..270 CDD:409353 2/3 (67%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 1/6 (17%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 1/1 (100%)
Ncam1XP_006510118.1 IgI_1_NCAM-1 20..116 CDD:409451 26/108 (24%)
Ig strand A 20..25 CDD:409451 2/4 (50%)
Ig strand A' 28..32 CDD:409451 0/3 (0%)
Ig strand B 34..44 CDD:409451 4/9 (44%)
Ig strand C 50..56 CDD:409451 2/5 (40%)
Ig strand C' 59..61 CDD:409451 1/1 (100%)
Ig strand D 69..75 CDD:409451 0/5 (0%)
Ig strand E 77..85 CDD:409451 1/7 (14%)
Ig strand F 92..100 CDD:409451 3/7 (43%)
Ig strand G 104..115 CDD:409451 3/20 (15%)
IG_like 124..190 CDD:214653 19/65 (29%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
IgI_3_NCAM-1 211..308 CDD:143207 23/97 (24%)
Ig strand A 211..216 CDD:143207 1/4 (25%)
Ig strand A' 220..226 CDD:143207 0/5 (0%)
Ig strand B 229..239 CDD:143207 5/9 (56%)
Ig strand C 243..249 CDD:143207 2/5 (40%)
Ig strand C' 251..253 CDD:143207 0/1 (0%)
Ig strand D 263..266 CDD:143207 0/2 (0%)
Ig strand E 271..277 CDD:143207 1/5 (20%)
Ig strand F 283..292 CDD:143207 2/8 (25%)
Ig strand G 295..307 CDD:143207 3/11 (27%)
IgI_NCAM-1 307..413 CDD:143277 2/3 (67%)
Ig strand A 307..312 CDD:143277 2/3 (67%)
Ig strand A' 316..320 CDD:143277
Ig strand B 325..333 CDD:143277
Ig strand C 339..345 CDD:143277
Ig strand C' 348..351 CDD:143277
Ig strand D 369..375 CDD:143277
Ig strand E 378..384 CDD:143277
Ig strand F 392..400 CDD:143277
Ig strand G 403..413 CDD:143277
IG_like 422..500 CDD:214653
Ig strand B 433..437 CDD:409353
Ig strand C 446..450 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
fn3 512..599 CDD:394996
fn3 649..731 CDD:394996
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.