DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Kirrel

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus


Alignment Length:331 Identity:82/331 - (24%)
Similarity:118/331 - (35%) Gaps:87/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PPTPPLSLQPSTPSITHFVNESFIIFCQ-TVQKDI-DTKWRDPRGQTRENTKGRVHIEK------ 99
            |||..||::|.|.    ...|..|..|| |...:| ..:|          .||...||.      
Mouse   254 PPTVTLSIEPQTV----LEGERVIFTCQATANPEILGYRW----------AKGGFLIEDAHESRY 304

  Fly   100 KTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQV---- 160
            :|....:...|.:        :|||. |:.|:.||:.          |||  :.|.....|    
Mouse   305 ETNVDYSFFTEPV--------SCEVY-NKVGSTNVST----------LVN--VHFAPRIVVYPKP 348

  Fly   161 QSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRL----------------SNGLYI 209
            .:...|.|..:.|...|.|...::|       ...:|....||                ||.|.:
Mouse   349 TTTDIGSDVTLTCVWVGNPPLTLTW-------TKKDSNMGPRLPGSPPEANLSAQVLSNSNQLLL 406

  Fly   210 RNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMG 274
            ::|:|||||.|||||  |.|....::: .:.|.:...|   ...:..||:|..|....:.|....
Mouse   407 KSVTQADAGTYTCRA--IVPRIGVAER-EVPLYVNGPP---IISSEAVQFAVRGDGGKVECFIGS 465

  Fly   275 EPPP---SFTWLHNNKGIVGFNHRIFV----ADYGATLQLQMKNASQFG---DYKCKVANPLGML 329
            .|||   ::.|..|... ||...|..|    :..|....|.:.|..:..   .|.|...|..|..
Mouse   466 TPPPDRIAWAWKENFLE-VGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG 529

  Fly   330 ERVIKL 335
            ..:|:|
Mouse   530 TAIIQL 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 21/74 (28%)
IG_like 256..336 CDD:214653 23/90 (26%)
IGc2 263..327 CDD:197706 17/73 (23%)
FN3 341..445 CDD:238020
KirrelXP_011238330.1 Ig 54..148 CDD:386229
Ig2_KIRREL3-like 170..251 CDD:143236
Ig 255..336 CDD:386229 29/115 (25%)
Ig_3 340..421 CDD:372822 22/87 (25%)
Ig5_KIRREL3 439..536 CDD:143306 24/101 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.