DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and DCC

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_005206.2 Gene:DCC / 1630 HGNCID:2701 Length:1447 Species:Homo sapiens


Alignment Length:466 Identity:105/466 - (22%)
Similarity:176/466 - (37%) Gaps:104/466 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PLSLQPSTPSITHFVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLL------ 105
            ||.....|.|:|.|:.::.::.|:.:.:.:.|                :|.:|....|.      
Human   139 PLRFLSQTESVTAFMGDTVLLKCEVIGEPMPT----------------IHWQKNQQDLTPIPGDS 187

  Fly   106 --------ALVFEHIALEDRGNWTCEVN---GNRNGNRNVNVEREFLASFELLVNQKISFGKTEQ 159
                    ||....:...|.|.:.|...   .:|.||     |.|.....:..:::::.|.:...
Human   188 RVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGN-----EAEVRILSDPGLHRQLYFLQRPS 247

  Fly   160 VQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRL-SNGLYIRNVSQADAGEYTCR 223
            .....||:||::.|.|.|.|.|..:|| .||.:..:.|.|::.| .:.|.|.||:..|:|.|||.
Human   248 NVVAIEGKDAVLECCVSGYPPPSFTWL-RGEEVIQLRSKKYSLLGGSNLLISNVTDDDSGMYTCV 311

  Fly   224 AMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKG 288
            ........|.|.::|:|:     |.||.|....: |||....:...|...|:|.|:..|:.|...
Human   312 VTYKNENISASAELTVLV-----PPWFLNHPSNL-YAYESMDIEFECTVSGKPVPTVNWMKNGDV 370

  Fly   289 IVGFNHRIFVADY-----GATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGPKPLGPR--- 345
            ::       .:||     |:.|::.....|..|.|:|...|..|..:...:|.. |||..|.   
Human   371 VI-------PSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIV-PKPAIPSSSV 427

  Fly   346 -----RFQLKKLYTNGF-ELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFS 404
                 |..:..|.::.| .|..:.|  :.....:|.:         |.| ||....:..:..:.:
Human   428 LPSAPRDVVPVLVSSRFVRLSWRPP--AEAKGNIQTF---------TVF-FSREGDNRERALNTT 480

  Fly   405 FHGGKHFIIPHLETNTTYLMRAASRNLAGLSDWS-PVKVFT--------------------TAAG 448
            ..|.....:.:|:....|..|..:.|..|..:.| |:||.|                    |:..
Human   481 QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTSPTSIL 545

  Fly   449 CSWSPWLYPSY 459
            .:|.|   |:|
Human   546 ITWEP---PAY 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 8/65 (12%)
Ig strand E 105..109 CDD:409353 2/17 (12%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 28/86 (33%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 182..186 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 19/84 (23%)
Ig strand B 266..270 CDD:409353 0/3 (0%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 23/133 (17%)
DCCNP_005206.2 IgI_1_Neogenin_like 39..136 CDD:409387
Ig strand A 39..42 CDD:409387
Ig strand A' 45..51 CDD:409387
Ig strand B 55..65 CDD:409387
Ig strand C 70..76 CDD:409387
Ig strand C' 78..81 CDD:409387
Ig strand D 88..93 CDD:409387
Ig strand E 95..101 CDD:409387
Ig strand F 113..120 CDD:409387
Ig strand G 125..136 CDD:409387
Ig_3 139..216 CDD:464046 16/92 (17%)
I-set 241..327 CDD:400151 28/86 (33%)
Ig strand B 257..261 CDD:409562 1/3 (33%)
Ig strand C 270..274 CDD:409562 0/3 (0%)
Ig strand E 293..297 CDD:409562 1/3 (33%)
Ig strand F 307..312 CDD:409562 3/4 (75%)
Ig strand G 322..325 CDD:409562 1/2 (50%)
Ig 334..417 CDD:472250 21/90 (23%)
Ig strand B 348..352 CDD:409388 0/3 (0%)
Ig strand C 361..365 CDD:409388 0/3 (0%)
Ig strand E 383..387 CDD:409388 1/3 (33%)
Ig strand F 397..402 CDD:409388 2/4 (50%)
Ig strand G 410..413 CDD:409388 0/2 (0%)
FN3 429..521 CDD:238020 20/103 (19%)
FN3 <478..901 CDD:442628 16/79 (20%)
FN3 946..1041 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1126..1152
Neogenin_C 1148..1445 CDD:461954
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1165..1222
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1394..1419
Interaction with MYO10. /evidence=ECO:0000269|PubMed:21642953 1432..1439
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.