DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and IGSF5

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_047296655.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:331 Identity:63/331 - (19%)
Similarity:104/331 - (31%) Gaps:130/331 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLLSQNAAILGQLDSTSSGGSGTGGAPPDRPPTP---------------------------- 46
            |.|:.|.:||            |||:|....:.|...                            
Human   114 LELIFLEKNA------------GSGSGNEVIEGPQNARVLKGSQARFNCTVSQGWKLIMWALSDM 166

  Fly    47 -PLSLQPSTPSITHFVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFE 110
             .||::|..|.||   |:.|            |..|..:|       |....|        ::..
Human   167 VVLSVRPMEPIIT---NDRF------------TSQRYDQG-------GNFTSE--------MIIH 201

  Fly   111 HIALEDRGNWTCEVNGNR-NGNRNVNVE---REFLASFELLVNQKISFGKTEQVQSVREGRDAMV 171
            ::...|.||..|.:..:| :|:..:.|:   ..|:.|..|:               |.|.....|
Human   202 NVEPSDSGNIRCSLQNSRLHGSAYLTVQVMGELFIPSVNLV---------------VAENEPCEV 251

  Fly   172 NCFVEGMPA-----PEVSWLYNGEYINTVNSTKH------NRLSNGLYIRNVSQADAGEYTCRAM 225
            .|    :|:     |::||    |....|:.:.:      :.|.:.:.|..::....|..||.| 
Human   252 TC----LPSHWTRLPDISW----ELGLLVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVA- 307

  Fly   226 RITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNL-----SCDAMGEPPPSFTWLHN 285
             ...:.......|:.|.:...|    .:|        ||.:|:     |..::|...|  ||...
Human   308 -TWKSLKARKSATVNLTVIRCP----QDT--------GGGINIPGVLSSLPSLGFSLP--TWGKV 357

  Fly   286 NKGIVG 291
            ..|:.|
Human   358 GLGLAG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 8/51 (16%)
Ig strand E 105..109 CDD:409353 0/3 (0%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 16/96 (17%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 0/3 (0%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 10/41 (24%)
Ig strand B 266..270 CDD:409353 1/8 (13%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353
Ig strand F 317..322 CDD:409353
FN3 341..445 CDD:238020
IGSF5XP_047296655.1 IG_like 135..228 CDD:214653 20/122 (16%)
Ig_3 233..308 CDD:464046 19/99 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.