Sequence 1: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017450901.1 | Gene: | Opcml / 116597 | RGDID: | 620635 | Length: | 354 | Species: | Rattus norvegicus |
Alignment Length: | 316 | Identity: | 64/316 - (20%) |
---|---|---|---|
Similarity: | 110/316 - (34%) | Gaps: | 91/316 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 FVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
Fly 124 VNGNRNGNRN-----VNVEREFL-ASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPE 182
Fly 183 VSWLYNGEYINTVNSTKHNRLSNG---------LYIRNVSQADAGEYTCRAMRITPTFSDSDQIT 238
Fly 239 ILLRIQHKPHWFFNETLPVQYAYVGGAVN----------LSCDAMGEPPPSFTWLHNNKGIVGFN 293
Fly 294 HRIFVADYGATLQLQMKNASQ--FGDYKCKVANPLGMLERVI---KLRPGPKPLGP 344 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 16/67 (24%) |
IG_like | 256..336 | CDD:214653 | 21/94 (22%) | ||
IGc2 | 263..327 | CDD:197706 | 17/75 (23%) | ||
FN3 | 341..445 | CDD:238020 | 2/4 (50%) | ||
Opcml | XP_017450901.1 | Ig | 44..132 | CDD:416386 | 16/79 (20%) |
Ig strand A' | 44..49 | CDD:409353 | |||
Ig strand B | 51..59 | CDD:409353 | |||
CDR1 | 59..63 | CDD:409353 | |||
FR2 | 64..70 | CDD:409353 | 0/1 (0%) | ||
Ig strand C | 64..70 | CDD:409353 | 0/1 (0%) | ||
CDR2 | 71..83 | CDD:409353 | 3/17 (18%) | ||
Ig strand C' | 72..76 | CDD:409353 | 2/3 (67%) | ||
Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
FR3 | 84..118 | CDD:409353 | 10/43 (23%) | ||
Ig strand D | 87..94 | CDD:409353 | 3/6 (50%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 0/8 (0%) | ||
FR4 | 125..132 | CDD:409353 | 0/6 (0%) | ||
Ig_3 | 135..206 | CDD:404760 | 20/98 (20%) | ||
Ig strand A | 135..138 | CDD:409353 | 0/2 (0%) | ||
Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 151..160 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 165..170 | CDD:409353 | 3/17 (18%) | ||
Ig strand C' | 171..174 | CDD:409353 | 1/2 (50%) | ||
Ig strand F | 198..206 | CDD:409353 | 5/7 (71%) | ||
Ig_3 | 223..300 | CDD:404760 | 18/89 (20%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 2/18 (11%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 279..283 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 306..309 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166337189 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |