DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and Opcml

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:316 Identity:64/316 - (20%)
Similarity:110/316 - (34%) Gaps:91/316 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
            ::|.|.|::..      :.||. ||          ||.|...|....:::.:::.:.|.|.:||.
  Rat    68 WLNRSTILYAG------NDKWSIDP----------RVIILVNTPTQYSIMIQNVDVYDEGPYTCS 116

  Fly   124 VNGNRNGNRN-----VNVEREFL-ASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPE 182
            |..:.:...:     |.|..:.: .|.::.||               ||....:.|...|.|.|.
  Rat   117 VQTDNHPKTSRVHLIVQVPPQIMNISSDITVN---------------EGSSVTLLCLAIGRPEPT 166

  Fly   183 VSWLYNGEYINTVNSTKHNRLSNG---------LYIRNVSQADAGEYTCRAMRITPTFSDSDQIT 238
            |:|             :|..:..|         |.|.::.:..:|||.|.|:.   ..:..|...
  Rat   167 VTW-------------RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALN---DVAAPDVRK 215

  Fly   239 ILLRIQHKPHWFFNETLPVQYAYVGGAVN----------LSCDAMGEPPPSFTWLHNNKGIVGFN 293
            :.:.:.:.|             |:..|.|          |||:|...|...|.|...:..:....
  Rat   216 VKITVNYPP-------------YISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGL 267

  Fly   294 HRIFVADYGATLQLQMKNASQ--FGDYKCKVANPLGMLERVI---KLRPGPKPLGP 344
            ..:.:.:.|....|...|.|:  :|:|.|...|.||.....|   ::.|.....||
  Rat   268 DGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAVAGP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/67 (24%)
IG_like 256..336 CDD:214653 21/94 (22%)
IGc2 263..327 CDD:197706 17/75 (23%)
FN3 341..445 CDD:238020 2/4 (50%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 16/79 (20%)
Ig strand A' 44..49 CDD:409353
Ig strand B 51..59 CDD:409353
CDR1 59..63 CDD:409353
FR2 64..70 CDD:409353 0/1 (0%)
Ig strand C 64..70 CDD:409353 0/1 (0%)
CDR2 71..83 CDD:409353 3/17 (18%)
Ig strand C' 72..76 CDD:409353 2/3 (67%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 10/43 (23%)
Ig strand D 87..94 CDD:409353 3/6 (50%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 0/8 (0%)
FR4 125..132 CDD:409353 0/6 (0%)
Ig_3 135..206 CDD:404760 20/98 (20%)
Ig strand A 135..138 CDD:409353 0/2 (0%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 1/8 (13%)
Ig strand C 165..170 CDD:409353 3/17 (18%)
Ig strand C' 171..174 CDD:409353 1/2 (50%)
Ig strand F 198..206 CDD:409353 5/7 (71%)
Ig_3 223..300 CDD:404760 18/89 (20%)
putative Ig strand A 224..230 CDD:409353 2/18 (11%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 1/3 (33%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337189
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.