DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and ncam1b

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_009289824.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1054 Species:Danio rerio


Alignment Length:352 Identity:87/352 - (24%)
Similarity:131/352 - (37%) Gaps:77/352 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLLSQNAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTV-- 72
            :|:||...||..| |:|.|.:.|..:                         |.||....|:.:  
Zfish     8 ILVLLFFDNAVSL-QVDITPAHGEIS-------------------------VGESRFFLCEVIGG 46

  Fly    73 QKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEV-NGNRNGNRNVNV 136
            .|:||  |..|.|:..|..:..:.:.:.......|...:..:::.|.:.|.. :|:::....|| 
Zfish    47 AKEID--WFAPAGEKIEPGRPDISVIRNDETSSTLTIYNAKVDNAGTYRCVASSGDQDAEATVN- 108

  Fly   137 EREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHN 201
                     |.:.|||:|......|...||.:|::.|.|...|.|.|.|.|.|..|......:..
Zfish   109 ---------LKIYQKITFTNVPSPQEFTEGDNAIIVCDVISSPPPTVLWKYKGAKIQFDKDVRFK 164

  Fly   202 RLSNG-LYIRNVSQADAGEYTCR----------------AMRITPTFSDSDQITILLRIQHKPHW 249
            .|||. |.||.:.:.|.|.|||.                .:.:.||          :||:...  
Zfish   165 TLSNNHLQIRGIRKTDEGVYTCEGRIKARGEVDFRSIKVVVNVLPT----------IRIRQAE-- 217

  Fly   250 FFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQ 314
             .|.|     |.:|.:..|:||..|.|.|..||..||..:...|...|..|......|.:....:
Zfish   218 -TNAT-----ADMGFSTLLACDPDGFPEPIVTWRRNNAPLESGNKYSFNEDGSEMTVLDVTKLDE 276

  Fly   315 FGDYKCKVANPLGMLERVIKLRPGPKP 341
             |||.|...|..|..|:.:.|:...:|
Zfish   277 -GDYTCIAKNKAGESEQELSLKVFVQP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 9/53 (17%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 27/102 (26%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 2/4 (50%)
Ig strand F 219..224 CDD:409353 3/20 (15%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 23/79 (29%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353 1/6 (17%)
Ig strand F 317..322 CDD:409353 3/4 (75%)
FN3 341..445 CDD:238020 1/1 (100%)
ncam1bXP_009289824.1 Ig 20..113 CDD:472250 23/130 (18%)
Ig strand B 37..41 CDD:409353 0/3 (0%)
Ig strand C 49..53 CDD:409353 2/5 (40%)
Ig strand E 77..81 CDD:409353 1/3 (33%)
Ig strand F 91..96 CDD:409353 1/4 (25%)
Ig strand G 104..107 CDD:409353 0/2 (0%)
Ig 117..186 CDD:472250 23/68 (34%)
Ig strand B 132..136 CDD:409353 1/3 (33%)
Ig strand C 145..149 CDD:409353 1/3 (33%)
Ig strand E 169..173 CDD:409353 1/3 (33%)
Ig strand F 183..188 CDD:409353 3/4 (75%)
Ig strand G 198..201 CDD:409353 0/2 (0%)
Ig 208..301 CDD:472250 30/111 (27%)
Ig strand B 228..232 CDD:409353 1/3 (33%)
Ig strand C 241..245 CDD:409353 1/3 (33%)
Ig strand E 264..268 CDD:409353 0/3 (0%)
Ig strand F 278..283 CDD:409353 3/4 (75%)
Ig strand G 291..294 CDD:409353 1/2 (50%)
Ig 300..414 CDD:472250 1/3 (33%)
Ig strand B 319..323 CDD:409353
Ig strand C 332..336 CDD:409353
Ig strand E 380..384 CDD:409353
Ig strand F 394..399 CDD:409353
Ig strand G 407..410 CDD:409353
IG_like 426..505 CDD:214653
Ig strand B 434..438 CDD:409353
Ig strand C 448..452 CDD:409353
Ig strand E 475..479 CDD:409353
Ig strand F 489..494 CDD:409353
FN3 513..606 CDD:238020
fn3 642..712 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.