DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and CHL1

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_006605.2 Gene:CHL1 / 10752 HGNCID:1939 Length:1224 Species:Homo sapiens


Alignment Length:387 Identity:87/387 - (22%)
Similarity:143/387 - (36%) Gaps:89/387 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DSTSSGGSGTGGAPPDRPPTPPLSLQP----STPSITHFVNESFIIFC-----QTVQKDIDTKWR 81
            ||:||...|: .|...:...|.|.|.|    |..|||....|..::.|     .|.|.|    |.
Human   232 DSSSSTEIGS-KANSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVD----WN 291

  Fly    82 D-----PRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFL 141
            .     |:|:..:...|:           .|..|:::.:|:||:.|..:             .||
Human   292 KIGGDLPKGRETKENYGK-----------TLKIENVSYQDKGNYRCTAS-------------NFL 332

  Fly   142 AS----FELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNR 202
            .:    |.::|.:...:.|..|......|.:.::.|..||.|.|.:.|..||..::     .|..
Human   333 GTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGILLCEAEGEPQPTIKWRVNGSPVD-----NHPF 392

  Fly   203 LSNGLYIRNVSQAD-----AGEYTCRAMRITPTF---SDSDQITILLRIQHKPHWFFNETLPVQY 259
            ..:.::.|.:|..:     ...|.|.|..:..|.   ::.|.:.:...||.|.        ...|
Human   393 AGDVVFPREISFTNLQPNHTAVYQCEASNVHGTILANANIDVVDVRPLIQTKD--------GENY 449

  Fly   260 A-YVGGAVNLSCDAMGEPPPSFTW--LHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCK 321
            | .||.:..|.|:....|....:|  :...|.:.|..:.|:   ...|||:........|.|.|.
Human   450 ATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEGRRYHIY---ENGTLQINRTTEEDAGSYSCW 511

  Fly   322 VANPLGM--------LERVIKLRPGPKPLGPRRFQLKKLYTNGFELDIQTPRMSNVSDEMQI 375
            |.|.:|.        :....|||..||  .||   :.||:.  .||..::...|::...:::
Human   512 VENAIGKTAVTANLDIRNATKLRVSPK--NPR---IPKLHM--LELHCESKCDSHLKHSLKL 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 12/56 (21%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 1/3 (33%)
Ig 153..239 CDD:472250 19/93 (20%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 0/3 (0%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 21/90 (23%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/5 (20%)
Ig strand E 302..309 CDD:409353 3/6 (50%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 7/35 (20%)
CHL1NP_006605.2 Ig 35..126 CDD:472250
Ig strand B 53..57 CDD:409396
Ig strand C 66..70 CDD:409396
Ig strand E 90..94 CDD:409396
Ig strand F 106..111 CDD:409396
Ig strand G 120..123 CDD:409396
IgI_2_L1-CAM_like 135..225 CDD:409432
Ig strand A 135..138 CDD:409432
Ig strand A' 140..144 CDD:409432
Ig strand B 147..155 CDD:409432
Ig strand C 162..168 CDD:409432
Ig strand C' 171..174 CDD:409432
Ig strand D 180..184 CDD:409432
Ig strand E 186..190 CDD:409432
Ig strand F 201..209 CDD:409432
Ig strand G 212..225 CDD:409432
Ig3_L1-CAM_like 262..344 CDD:409394 22/109 (20%)
Ig strand B 274..278 CDD:409394 0/3 (0%)
Ig strand C 287..291 CDD:409394 2/7 (29%)
Ig strand E 309..313 CDD:409394 1/14 (7%)
Ig strand F 323..328 CDD:409394 2/4 (50%)
Ig strand G 336..339 CDD:409394 0/2 (0%)
Ig4_L1-NrCAM_like 348..435 CDD:409367 19/91 (21%)
Ig strand B 364..368 CDD:409367 0/3 (0%)
Ig strand C 377..381 CDD:409367 0/3 (0%)
Ig strand E 400..404 CDD:409367 1/3 (33%)
Ig strand F 414..419 CDD:409367 2/4 (50%)
Ig strand G 427..430 CDD:409367 0/2 (0%)
Ig 448..525 CDD:472250 20/79 (25%)
Ig strand B 457..461 CDD:409390 1/3 (33%)
Ig strand C 470..474 CDD:409390 0/3 (0%)
Ig strand E 493..497 CDD:409390 2/3 (67%)
Ig strand F 507..512 CDD:409390 2/4 (50%)
Ig strand G 520..523 CDD:409390 0/2 (0%)
Ig 548..617 CDD:409353 3/19 (16%)
Ig strand B 548..552 CDD:409353 2/3 (67%)
Ig strand C 565..569 CDD:409353 0/2 (0%)
DGEA 571..574
Ig strand E 590..594 CDD:409353
Ig strand F 604..609 CDD:409353
FN3 <616..>868 CDD:442628
FN3 628..717 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..732
FN3 834..927 CDD:238020
FN3 932..1027 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1179
FIG[AQ]Y 1197..1201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1205..1224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.