DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and iglon5

DIOPT Version :9

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:298 Identity:65/298 - (21%)
Similarity:109/298 - (36%) Gaps:72/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVNESFIIFCQTVQKDIDTKWR-DPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCE 123
            ::|.|.|::   ..||   ||. |.|.|...|||..          .::|..|:.:.|.|.:||.
 Frog    59 WLNRSNILY---AGKD---KWSIDSRVQLLTNTKSE----------YSIVITHVDVADEGLYTCS 107

  Fly   124 VNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYN 188
            ..         ..::...:...|:|.............:|.||.:..:.|...|.|.|.::|   
 Frog   108 FQ---------TEDKPHTSQVYLIVQVPAKIVNISSSVTVNEGSNVNLQCLAVGKPEPTITW--- 160

  Fly   189 GEYINTVNSTKHNRLSNG-------LYIRNVSQADAGEYTCRAMRITPT-FSDSDQITILLRIQH 245
                        .:||.|       |.|..:::..||:|.|    :|.. .|..|...:.:.:.:
 Frog   161 ------------QQLSEGFSSEGELLEITEINRQQAGDYEC----VTSNGVSVPDTKKVQITVNY 209

  Fly   246 KPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMK 310
            .|  :..:....| :.||....|.|.||..||..|.|..:.|      .|:.....|.:::.:..
 Frog   210 PP--YITDVKNAQ-SPVGRPATLRCKAMAVPPAEFEWYKDEK------RRLISGTEGLSIKTESS 265

  Fly   311 ---------NASQFGDYKCKVANPLGMLERVIK-LRPG 338
                     .:..:|:|.|..:|.||.....:: |:||
 Frog   266 WSVIVFSNVTSRHYGNYTCLASNKLGSFNSSLRLLKPG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/65 (25%)
IG_like 256..336 CDD:214653 20/89 (22%)
IGc2 263..327 CDD:197706 16/72 (22%)
FN3 341..445 CDD:238020
iglon5XP_002938252.1 Ig 31..123 CDD:299845 20/88 (23%)
IG_like 35..123 CDD:214653 20/88 (23%)
Ig 126..207 CDD:299845 20/99 (20%)
I-set 128..207 CDD:254352 20/97 (21%)
I-set 210..299 CDD:254352 21/97 (22%)
Ig 227..298 CDD:143165 17/76 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.