DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and chl1b

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_017212175.2 Gene:chl1b / 100318566 ZFINID:ZDB-GENE-091105-1 Length:1294 Species:Danio rerio


Alignment Length:365 Identity:84/365 - (23%)
Similarity:138/365 - (37%) Gaps:48/365 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DSTSSGGSGTGGAPPDRPPT--PPLSLQPSTPSITHFVNESFIIFCQTVQKDIDT---KW----- 80
            ||:|..|.|...:..:|.|:  .|..::..|..:.   .|...:.|  :.:...|   :|     
Zfish   241 DSSSGSGRGYANSLLERKPSLLAPTGMESHTRLVK---GEDLQLEC--IAEGFPTPKVEWVKIGF 300

  Fly    81 -RDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASF 144
             :.|.         ||.:|  :.|.| |..|.:..||.|.:.|         |..|...|.:..|
Zfish   301 NKLPE---------RVVVE--SHGKL-LTVEMVNEEDEGKYMC---------RAKNPHGEVVHHF 344

  Fly   145 ELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNG-LY 208
            .:.|.:...|....|.|.|..|.|.::.|.|:|.|.|.|.|..||..:|.|.::....|.:| :.
Zfish   345 HVTVEEPPEFEIEPQSQLVTIGADVLIKCVVKGNPQPTVGWRVNGRPLNEVPTSNRKILKDGTIS 409

  Fly   209 IRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQY-AYVGGAVNLSCDA 272
            |.|.:..::..|.|.|.....|...:..| :::.||  |.......|  || |..|.:|.:.|..
Zfish   410 IHNANPENSAVYQCEATNKHGTILANANI-MIMNIQ--PLILTENNL--QYMAVEGKSVVMHCKV 469

  Fly   273 MGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKVANPLG--MLERVIKL 335
            ...|..|.||...:........| |......:|::........|:|.|...|..|  .:...:::
Zfish   470 FSSPASSITWSKADSANAVEGER-FTVHQNGSLEIHNVMKEDMGEYSCFAQNTEGKVAIAATLEV 533

  Fly   336 RPGPKPLGPRRFQLKKLYTNGFELDIQTPRMSNVSDEMQI 375
            :...:.:.|.| .|:.|.....:...|.....:..|:.::
Zfish   534 KDPTRIVDPPR-DLRVLAGTTIQFSCQPEFDPSFGDDFEV 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 13/60 (22%)
Ig strand E 105..109 CDD:409353 2/3 (67%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 26/86 (30%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 1/4 (25%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 18/82 (22%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 2/3 (67%)
Ig strand E 302..309 CDD:409353 1/6 (17%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 6/35 (17%)
chl1bXP_017212175.2 Ig 42..135 CDD:472250
Ig strand B 61..65 CDD:409396
Ig strand C 74..78 CDD:409396
Ig strand E 99..103 CDD:409396
Ig strand F 115..120 CDD:409396
Ig strand G 129..132 CDD:409396
Ig 144..234 CDD:472250
Ig strand B 158..162 CDD:409432
Ig strand C 172..176 CDD:409432
Ig strand E 195..199 CDD:409432
Ig strand F 210..215 CDD:409432
Ig strand G 226..229 CDD:409432
Ig 267..348 CDD:472250 21/106 (20%)
Ig strand B 279..283 CDD:409394 0/3 (0%)
Ig strand C 292..296 CDD:409394 0/3 (0%)
Ig strand E 314..318 CDD:409394 2/4 (50%)
Ig strand F 328..333 CDD:409394 1/13 (8%)
Ig strand G 341..344 CDD:409394 0/2 (0%)
Ig 359..438 CDD:472250 24/78 (31%)
Ig strand B 369..373 CDD:409367 0/3 (0%)
Ig strand C 382..386 CDD:409367 1/3 (33%)
Ig strand E 406..410 CDD:409367 1/3 (33%)
Ig strand F 420..425 CDD:409367 2/4 (50%)
Ig strand G 433..436 CDD:409367 0/2 (0%)
Ig 447..533 CDD:472250 19/88 (22%)
Ig strand B 463..467 CDD:409544 1/3 (33%)
Ig strand C 476..480 CDD:409544 2/3 (67%)
Ig strand E 499..503 CDD:409544 1/3 (33%)
Ig strand F 513..518 CDD:409544 2/4 (50%)
Ig strand G 526..529 CDD:409544 0/2 (0%)
Ig 535..635 CDD:472250 6/39 (15%)
Ig strand B 554..558 CDD:409359 0/3 (0%)
Ig strand C 571..575 CDD:409359 0/2 (0%)
Ig strand E 594..598 CDD:409359
Ig strand F 608..613 CDD:409359
Ig strand G 621..624 CDD:409359
FN3 632..722 CDD:238020
FN3 <702..1101 CDD:442628
FN3 1070..1142 CDD:214495
Bravo_FIGEY 1196..1279 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.