DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33543 and ncam2

DIOPT Version :10

Sequence 1:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 / 100151722 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis


Alignment Length:408 Identity:103/408 - (25%)
Similarity:174/408 - (42%) Gaps:70/408 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ESFIIFCQTV--QKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVN 125
            |...:||:..  .|...| |........||.|  ..:.:..|   .|..::|...|.|.:.|...
 Frog   255 EDITLFCRATGSPKPYIT-WHRNGKLVEENEK--YDLREDNT---ELTVKNIISTDSGLYVCRAT 313

  Fly   126 GNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSW----- 185
             |:.|   ...::.||   ::.|...|.  :.:...::..|. ..:.|..||.|.||::|     
 Frog   314 -NKAG---FTEKQSFL---QVFVQPHIV--QLQNETTIEHGH-VTLTCEAEGEPIPEITWKRSSD 368

  Fly   186 ---LYNGE--YINTVNSTKHNRLSNGLYIRNVSQADAGEYTCR-AMRITPTFSDSDQITILLRIQ 244
               .|:|:  ....:.||.|:..|: |:|::|..:|||.|.|. |.||     ...|.::.|.|:
 Frog   369 GMIFYDGDKSQDGRIESTGHHGKSS-LHIKSVMLSDAGRYDCEAASRI-----GGHQKSMYLNIE 427

  Fly   245 HKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADY--GATLQL 307
            :.|.:..|:|  :.|::....:|:|||....||.|..| ..:|.::...:...:..|  |..:.|
 Frog   428 YAPKFISNQT--IYYSWENNPINISCDVTSNPPSSIYW-SRDKLLLPARNITNIKTYRDGKRILL 489

  Fly   308 QMKNAS--QFGDYKCKVANPLG--MLERVIKLRPGP-KPLGPRRFQLKKLYTNGFELDIQTPRMS 367
            ::...|  .||.|.|...|.:|  :.|.::.|...| .|.|.|..:|.:.|...|         .
 Frog   490 EITPLSDNDFGRYNCTAINSIGSRIQEYILTLADVPSSPYGLRVIELSQTYAKVF---------F 545

  Fly   368 NVSDE---MQIYGYRVAYMSDTEFK-FSAGNWSYAKQRDFSFHGGKHFII-PHLETNTTYLMRAA 427
            |..|.   :.|:.|::      :|| .|:..|...:.     ||.:..|: .:|:.||||.::.|
 Frog   546 NKPDSHGGVPIHHYQM------DFKEVSSEIWKVVRS-----HGTQTIIVLGNLDANTTYEVKVA 599

  Fly   428 SRNLAGLSDWSPVKVFTT 445
            :.|..|..::|..::|.|
 Frog   600 AVNGKGKGEYSKTEIFQT 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 11/53 (21%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 26/96 (27%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 2/11 (18%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 2/5 (40%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 21/85 (25%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 1/3 (33%)
Ig strand E 302..309 CDD:409353 2/6 (33%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 27/108 (25%)
ncam2XP_012811963.1 Ig 50..142 CDD:472250
Ig strand B 67..71 CDD:409452
Ig strand C 79..83 CDD:409452
Ig strand E 105..109 CDD:409452
Ig strand F 119..124 CDD:409452
Ig strand G 133..136 CDD:409452
IG_like 150..234 CDD:214653
Ig strand B 161..165 CDD:409353
Ig strand C 174..178 CDD:409353
Ig strand E 198..202 CDD:409353
Ig strand F 212..217 CDD:409353
Ig 238..327 CDD:472250 19/84 (23%)
Ig strand B 257..261 CDD:409301 0/3 (0%)
Ig strand C 270..274 CDD:409301 1/4 (25%)
Ig strand E 293..297 CDD:409301 2/6 (33%)
Ig strand F 307..312 CDD:409301 1/4 (25%)
Ig strand G 320..323 CDD:409301 0/2 (0%)
Ig 329..426 CDD:472250 29/105 (28%)
Ig strand B 347..351 CDD:143278 0/3 (0%)
Ig strand C 360..364 CDD:143278 1/3 (33%)
Ig strand E 392..396 CDD:143278 2/4 (50%)
Ig strand F 406..411 CDD:143278 2/4 (50%)
Ig strand G 419..422 CDD:143278 1/2 (50%)
Ig_3 430..508 CDD:464046 21/80 (26%)
FN3 525..617 CDD:238020 28/111 (25%)
fn3 623..707 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.