DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and Cadm3

DIOPT Version :10

Sequence 1:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001399743.1 Gene:Cadm3 / 94332 MGIID:2137858 Length:430 Species:Mus musculus


Alignment Length:463 Identity:100/463 - (21%)
Similarity:168/463 - (36%) Gaps:127/463 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SMGPGGGGSGSGGISSKDSHVKTKDIDAVEGKSVSLPCPITEPLDNVYMVLWFRDNAGIPLYSFD 96
            |..|||..      .|:|.:.:.:|::      :..|.|:.|.|.:..                 
Mouse    16 SWAPGGAN------LSQDGYWQEQDLE------LGTPAPLEEALSSTV----------------- 51

  Fly    97 VRDKESREQPRHWSAPEVFGSRAKFHFDSQPATLEIKDIKRHDQGIYRCRV-DFRTSQTQSFRFN 160
                        ||.|::..|:     ||||.|.: :.:......:.:|:| |...|..|     
Mouse    52 ------------WSNPDLLASQ-----DSQPWTSD-ETVVAGGTVVLKCQVKDHEDSSLQ----- 93

  Fly   161 LSVIILPEQPIIMDRWGRQLNGT-QLGPKQEGDDIVITCRVVGGRPQPQVRWLVNGLLVDNQNEH 224
                           |......| ..|.|:...|..|  ::|...|......:.|..|.|     
Mouse    94 ---------------WSNPAQQTLYFGEKRALRDNRI--QLVSSTPHELSISISNVALAD----- 136

  Fly   225 NSGDVIENRLLWPSVQRNDLNSVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADR 289
             .|:                   :||......:...|....:|.:..||::...   .||:....
Mouse   137 -EGE-------------------YTCSIFTMPVRTAKSLVTVLGIPQKPIITGY---KSSLREKE 178

  Fly   290 RYEVSCESSGSRPNAIITWYKGKRQL-----RRTKDDISKNST-RSELSFVPTTDDDGKSITCRA 348
            ...::|:||||:|.|.:||.||.::|     |..:|...|..| .|.:||..|.:|||.:|.|..
Mouse   179 TATLNCQSSGSKPAAQLTWRKGDQELHGDQTRIQEDPNGKTFTVSSSVSFQVTREDDGANIVCSV 243

  Fly   349 ENPNVNGLYLETMWKLNVVYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGI 413
            .:.::.|....|..::.|:|.|...:|    ..|...:||..:...|..:.||..::.:|:..| 
Mouse   244 NHESLKGADRSTSQRIEVLYTPTAMIR----PEPAHPREGQKLLLHCEGRGNPVPQQYVWVKEG- 303

  Fly   414 HLEHNTSARVIRSNQ--SLVLQKITKHYAGNYACSAINDEGE-----TVSNQLPLRVKYTPMCKH 471
                  |...::..|  :|:...:.|..:|.|.|:|.::.|.     |::...|..|..:....|
Mouse   304 ------SEPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYTAYFTLNVNDPSPVPSSSSTYH 362

  Fly   472 ADRVILIG 479
            |    :||
Mouse   363 A----IIG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001400995.1 V-set 55..163 CDD:462230 19/108 (18%)
Ig_3 190..254 CDD:464046 10/63 (16%)
Ig <292..366 CDD:472250 27/79 (34%)
Ig strand B 292..295 CDD:409418 0/2 (0%)
Ig strand C 305..309 CDD:409418 1/3 (33%)
Ig strand E 329..333 CDD:409418 1/3 (33%)
Ig strand F 343..348 CDD:409418 2/4 (50%)
Ig strand G 359..362 CDD:409418 1/2 (50%)
Ig 382..457 CDD:472250 18/81 (22%)
Ig strand B 391..395 CDD:409405 0/3 (0%)
Ig strand C 405..409 CDD:409405 0/3 (0%)
Ig strand E 428..432 CDD:409405 2/5 (40%)
Ig strand F 442..447 CDD:409405 2/4 (50%)
Ig 486..554 CDD:409353
Ig strand B 486..490 CDD:409353
Ig strand C 500..504 CDD:409353
Ig strand E 526..530 CDD:409353
Ig strand F 540..545 CDD:409353
Cadm3NP_001399743.1 IgV_1_Necl-1 64..158 CDD:143290 23/141 (16%)
Ig strand A 64..67 CDD:143290 2/2 (100%)
FR1 65..83 CDD:143290 2/18 (11%)
Ig strand A' 68..74 CDD:143290 0/6 (0%)
Ig strand B 76..84 CDD:143290 1/7 (14%)
CDR1 84..89 CDD:143290 2/4 (50%)
FR2 90..97 CDD:143290 3/26 (12%)
Ig strand C 90..96 CDD:143290 3/25 (12%)
CDR2 98..109 CDD:143290 3/10 (30%)
Ig strand C' 100..104 CDD:143290 1/3 (33%)
Ig strand C' 106..109 CDD:143290 1/2 (50%)
FR3 110..145 CDD:143290 10/61 (16%)
Ig strand D 114..121 CDD:143290 2/8 (25%)
Ig strand E 124..130 CDD:143290 0/5 (0%)
Ig strand F 137..145 CDD:143290 3/26 (12%)
CDR3 146..149 CDD:143290 0/2 (0%)
Ig strand G 149..158 CDD:143290 1/8 (13%)
FR4 151..158 CDD:143290 1/6 (17%)
Ig 159..261 CDD:472250 32/104 (31%)
Ig strand B 180..184 CDD:409353 0/3 (0%)
Ig strand C 194..198 CDD:409353 1/3 (33%)
Ig strand E 224..228 CDD:409353 1/3 (33%)
Ig strand F 238..243 CDD:409353 2/4 (50%)
Ig strand G 254..257 CDD:409353 1/2 (50%)
IG_like 271..348 CDD:214653 18/83 (22%)
Ig strand B 282..286 CDD:409353 0/3 (0%)
Ig strand C 296..300 CDD:409353 0/3 (0%)
Ig strand E 314..318 CDD:409353 1/3 (33%)
Ig strand F 328..333 CDD:409353 2/4 (50%)
4.1m 386..401 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.