DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and SIGLEC12

DIOPT Version :9

Sequence 1:NP_001014485.3 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_443729.1 Gene:SIGLEC12 / 89858 HGNCID:15482 Length:595 Species:Homo sapiens


Alignment Length:539 Identity:124/539 - (23%)
Similarity:193/539 - (35%) Gaps:149/539 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLAMALLMPVTLARLHSTSGVGMSGGGSSMGPGGGGSGSGGISSKDSHVKT--KDIDAVEGKSV 65
            :||.:.||.|:...|:                         |...:..::.|  |.:...||..|
Human     1 MLLLLLLLPPLLCGRV-------------------------GAKEQKDYLLTMQKSVTVQEGLCV 40

  Fly    66 SLPCPITEPLDNVYMVLWFRDNAGIPL--YSFDVRDKESREQPRHWSAP------EVFGSRAKFH 122
            |:.|..:.|.:.     |   .|..|:  |.|...|..||..|...:.|      |   :|.:||
Human    41 SVLCSFSYPQNG-----W---TASDPVHGYWFRAGDHVSRNIPVATNNPARAVQEE---TRDRFH 94

  Fly   123 FDSQP----ATLEI---KRHDQGIY----------------RCRVDFRTSQTQSFRFNLSVIILP 164
            ....|    .||.|   :..|.|.|                :..|:...||....|:.|.|   |
Human    95 LLGDPQNKDCTLSIRDTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEV---P 156

  Fly   165 EQPIIMDRWG-----------RQLNGTQLGPK-----QEGDDIVITCRVVGGRPQPQVRWLVNG- 212
            |...:.:  |           ...|.|...|.     :||.||.....|....|..:|:...:| 
Human   157 ESVTVQE--GLCVSVPCSVLYPHYNWTASSPVYGSWFKEGADIPWDIPVATNTPSGKVQEDTHGR 219

  Fly   213 --LLVDNQNEHNSGDVIENRLLWPSVQRNDLNSVFTCQALNTQLDKPKEK-SFILD---MHLKPL 271
              ||.|.|..:.|..:.:.|       :.|....:      .|:::...| ::|.|   :|:..|
Human   220 FLLLGDPQTNNCSLSIRDAR-------KGDSGKYY------FQVERGSRKWNYIYDKLSVHVTAL 271

  Fly   272 V-VKILEPPSSMIADRRYEVSCE-----SSGSRPNAIITWYKGKRQLRRTKDDISKNSTRSE-LS 329
            . :.....|.::.:.....::|.     ..|:.|.  |||      :..:...:....|||. ||
Human   272 THMPTFSIPGTLESGHPRNLTCSVPWACEQGTPPT--ITW------MGASVSSLDPTITRSSMLS 328

  Fly   330 FVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVVYPP--------------LVTLRLGSTLTPD 380
            .:|...|.|.|:||:...|.. |:.:....:||:.|||              ..|||.||.|:  
Human   329 LIPQPQDHGTSLTCQVTLPGA-GVTMTRAVRLNISYPPQNLTMTVFQGDGTASTTLRNGSALS-- 390

  Fly   381 DIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRSNQSLVLQKITKHYAGNYACSAI 445
             :.||..::..|.|.|||..| |.|....:.|..:.|:.:    ..|.|.::.....|.:.|.|.
Human   391 -VLEGQSLHLVCAVDSNPPAR-LSWTWGSLTLSPSQSSNL----GVLELPRVHVKDEGEFTCRAQ 449

  Fly   446 NDEG-ETVSNQLPLRVKYT 463
            |..| :.:|..|.|:.:||
Human   450 NPLGSQHISLSLSLQNEYT 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001014485.3 IG_like 55..160 CDD:214653 33/135 (24%)
Ig 57..160 CDD:299845 32/133 (24%)
Ig 188..251 CDD:299845 14/65 (22%)
Ig 289..363 CDD:299845 20/79 (25%)
IG_like 289..351 CDD:214653 18/67 (27%)
Ig_2 376..460 CDD:290606 23/84 (27%)
IG_like 383..454 CDD:214653 19/71 (27%)
Ig 470..548 CDD:299845
IG_like 481..557 CDD:214653
SIGLEC12NP_443729.1 Ig 24..142 CDD:325142 30/128 (23%)
Ig 151..269 CDD:325142 28/135 (21%)
Ig 232..345 CDD:325142 27/133 (20%)
IG_like 389..462 CDD:214653 21/80 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 512..560
ITIM motif 563..568
SLAM-like motif 586..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.