DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and NECTIN1

DIOPT Version :10

Sequence 1:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_002846.3 Gene:NECTIN1 / 5818 HGNCID:9706 Length:517 Species:Homo sapiens


Alignment Length:438 Identity:89/438 - (20%)
Similarity:131/438 - (29%) Gaps:173/438 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GKSVSLPCPITEPLDNVYM--VLWFRDNAG----IPLY--SFDVRDKESREQPRHWSAPEVFGSR 118
            |..|.|.|....||.:|.:  |.|.:...|    :.:|  |..|            |....:..|
Human    44 GTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGV------------SVLAPYRER 96

  Fly   119 AKFHFDS-QPATLEIKDIKRHDQGIYRCR-VDFRTSQTQSFRFNLSVIILPEQPIIMDRWGRQLN 181
            .:|...| ...|:.:..::..|:|:|.|. ..|.|...:| :.||:|:..|      ..|   :.
Human    97 VEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRES-QLNLTVMAKP------TNW---IE 151

  Fly   182 GTQ--LGPKQEGDD--IVITCRVVGGRPQPQVRWLVNGLLVDNQNEHNSGDVIENRLLWPSVQRN 242
            |||  |..|:..||  :|.||....|:|...|.|                   |.||        
Human   152 GTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSW-------------------ETRL-------- 189

  Fly   243 DLNSVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADRRYEVSCESSGSRPNAIIT 307
                                                                             
Human   190 ----------------------------------------------------------------- 189

  Fly   308 WYKGKRQLRRTKDDISKNSTRSELSFVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVVYPPLV 372
              ||:.:.:..::.....:..|....||:.:...:|:.|..   |.:....:....|||.|.|.|
Human   190 --KGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIV---NYHMDRFKESLTLNVQYEPEV 249

  Fly   373 TLRLGSTLTPDDIKEG---------DDVYFECHVQSNPQWRKLLW------LHNGIHLEHNTSAR 422
            |:            ||         .||...|...:||...:..|      |..|:..::.|...
Human   250 TI------------EGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTLFF 302

  Fly   423 VIRSNQSLVLQKITKHYAGNYACSAINDEGETVSNQLPLRV---KYTP 467
            ....|.||         ||.|.|.|.|..| |.|.|:.:.:   .|||
Human   303 KGPINYSL---------AGTYICEATNPIG-TRSGQVEVNITEFPYTP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001400995.1 V-set 55..163 CDD:462230 27/110 (25%)
Ig_3 190..254 CDD:464046 12/65 (18%)
Ig <292..366 CDD:472250 9/73 (12%)
Ig strand B 292..295 CDD:409418 0/2 (0%)
Ig strand C 305..309 CDD:409418 0/3 (0%)
Ig strand E 329..333 CDD:409418 1/3 (33%)
Ig strand F 343..348 CDD:409418 2/4 (50%)
Ig strand G 359..362 CDD:409418 0/2 (0%)
Ig 382..457 CDD:472250 22/89 (25%)
Ig strand B 391..395 CDD:409405 1/3 (33%)
Ig strand C 405..409 CDD:409405 1/9 (11%)
Ig strand E 428..432 CDD:409405 2/3 (67%)
Ig strand F 442..447 CDD:409405 2/4 (50%)
Ig 486..554 CDD:409353
Ig strand B 486..490 CDD:409353
Ig strand C 500..504 CDD:409353
Ig strand E 526..530 CDD:409353
Ig strand F 540..545 CDD:409353
NECTIN1NP_002846.3 IgV_1_Nectin-1_like 31..143 CDD:409469 27/111 (24%)
FR1 31..54 CDD:409469 4/9 (44%)
Ig strand A 31..35 CDD:409469
Ig strand A' 37..41 CDD:409469
Ig strand B 46..54 CDD:409469 3/7 (43%)
CDR1 55..62 CDD:409469 3/6 (50%)
FR2 63..69 CDD:409469 2/5 (40%)
Ig strand C 64..69 CDD:409469 2/4 (50%)
CDR2 70..89 CDD:409469 4/30 (13%)
Ig strand C' 79..84 CDD:409469 1/4 (25%)
Ig strand C' 86..90 CDD:409469 2/15 (13%)
FR3 90..128 CDD:409469 8/37 (22%)
Ig strand D 97..101 CDD:409469 1/3 (33%)
Ig strand E 106..113 CDD:409469 1/6 (17%)
Ig strand F 120..128 CDD:409469 3/7 (43%)
CDR3 129..132 CDD:409469 1/2 (50%)
Ig strand G 132..142 CDD:409469 3/10 (30%)
FR4 133..143 CDD:409469 3/10 (30%)
IgC1_2_Nectin-1_like 146..243 CDD:143298 28/202 (14%)
Ig strand A 146..152 CDD:143298 2/14 (14%)
Ig strand B 168..175 CDD:143298 3/6 (50%)
Ig strand C 180..186 CDD:143298 2/24 (8%)
Ig strand C' 188..190 CDD:143298 2/76 (3%)
Ig strand D 191..199 CDD:143298 1/7 (14%)
Ig strand E 205..213 CDD:143298 1/7 (14%)
Ig strand F 223..230 CDD:143298 2/9 (22%)
Ig strand G 234..240 CDD:143298 0/5 (0%)
Ig 247..333 CDD:472250 27/107 (25%)
Ig strand B 265..269 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Interaction with FGFR. /evidence=ECO:0000250|UniProtKB:Q9JKF6 282..299 3/16 (19%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
Ig strand G 330..333 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.