DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and CADM3

DIOPT Version :10

Sequence 1:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster
Sequence 2:XP_024304528.1 Gene:CADM3 / 57863 HGNCID:17601 Length:481 Species:Homo sapiens


Alignment Length:442 Identity:93/442 - (21%)
Similarity:152/442 - (34%) Gaps:149/442 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 WSAPEVFGSRAKFHFDSQPATLEIKDIKRHDQGIYRCRVDFRTSQTQSFRFNLSVIILPEQPIIM 173
            ||:|::..|                      ||...|.                     |.|:.:
Human    54 WSSPDMLAS----------------------QGPLLCW---------------------EHPLAI 75

  Fly   174 D-RWGRQLNGTQLGPKQEGDDIVITCRVVGGRP--------------QPQVRWLVNGLLVDNQNE 223
            . :|.   :..|...||.|..     :||.|||              ||   |..:..:|     
Human    76 SWKWN---SSNQERNKQTGRG-----KVVAGRPNVEQQICLCVFRDSQP---WTSDETVV----- 124

  Fly   224 HNSGDVI---------ENRLLWPSVQRNDL----------NSV---------------------- 247
             ..|.|:         ::.|.|.:..:..|          |.:                      
Human   125 -AGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADE 188

  Fly   248 --FTCQALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADRRYEVSCESSGSRPNAIITWYK 310
              :||......:...|....:|.:..||::...   .||:.......::|:||||:|.|.:||.|
Human   189 GEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGY---KSSLREKDTATLNCQSSGSKPAARLTWRK 250

  Fly   311 GKRQL-----RRTKDDISKNST-RSELSFVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVVYP 369
            |.::|     |..:|...|..| .|.::|..|.:|||.||.|...:.::.|....|..::.|:|.
Human   251 GDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYT 315

  Fly   370 PLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRSNQ--SLVL 432
            |...:|    ..|...:||..:...|..:.||..::.||       |...|...::..|  :|:.
Human   316 PTAMIR----PDPPHPREGQKLLLHCEGRGNPVPQQYLW-------EKEGSVPPLKMTQESALIF 369

  Fly   433 QKITKHYAGNYACSAINDEGE-----TVSNQLPLRVKYTPMCKHADRVILIG 479
            ..:.|..:|.|.|:|.::.|.     |::...|..|..:....||    :||
Human   370 PFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHA----IIG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001400995.1 V-set 55..163 CDD:462230 7/53 (13%)
Ig_3 190..254 CDD:464046 18/120 (15%)
Ig <292..366 CDD:472250 27/79 (34%)
Ig strand B 292..295 CDD:409418 0/2 (0%)
Ig strand C 305..309 CDD:409418 1/3 (33%)
Ig strand E 329..333 CDD:409418 1/3 (33%)
Ig strand F 343..348 CDD:409418 3/4 (75%)
Ig strand G 359..362 CDD:409418 1/2 (50%)
Ig 382..457 CDD:472250 19/81 (23%)
Ig strand B 391..395 CDD:409405 0/3 (0%)
Ig strand C 405..409 CDD:409405 1/3 (33%)
Ig strand E 428..432 CDD:409405 2/5 (40%)
Ig strand F 442..447 CDD:409405 2/4 (50%)
Ig 486..554 CDD:409353
Ig strand B 486..490 CDD:409353
Ig strand C 500..504 CDD:409353
Ig strand E 526..530 CDD:409353
Ig strand F 540..545 CDD:409353
CADM3XP_024304528.1 IgV_1_Necl-1 115..209 CDD:143290 13/102 (13%)
Ig strand A 115..118 CDD:143290 2/5 (40%)
FR1 116..134 CDD:143290 5/26 (19%)
Ig strand A' 119..125 CDD:143290 1/11 (9%)
Ig strand B 127..135 CDD:143290 2/7 (29%)
CDR1 135..140 CDD:143290 0/4 (0%)
FR2 141..148 CDD:143290 2/6 (33%)
Ig strand C 141..147 CDD:143290 2/5 (40%)
CDR2 149..160 CDD:143290 1/10 (10%)
Ig strand C' 151..155 CDD:143290 1/3 (33%)
Ig strand C' 157..160 CDD:143290 0/2 (0%)
FR3 161..196 CDD:143290 3/34 (9%)
Ig strand D 165..172 CDD:143290 0/6 (0%)
Ig strand E 175..181 CDD:143290 0/5 (0%)
Ig strand F 188..196 CDD:143290 2/7 (29%)
CDR3 197..200 CDD:143290 0/2 (0%)
Ig strand G 200..209 CDD:143290 1/8 (13%)
FR4 202..209 CDD:143290 1/6 (17%)
IgI_2_Necl-1 210..312 CDD:409502 32/104 (31%)
Ig strand A 210..213 CDD:409502 1/2 (50%)
Ig strand A' 216..220 CDD:409502 1/3 (33%)
Ig strand B 229..239 CDD:409502 2/9 (22%)
Ig strand C 242..251 CDD:409502 4/8 (50%)
Ig strand C' 252..255 CDD:409502 0/2 (0%)
Ig strand D 258..265 CDD:409502 1/6 (17%)
Ig strand E 270..280 CDD:409502 2/9 (22%)
Ig strand F 288..296 CDD:409502 3/7 (43%)
Ig strand G 304..311 CDD:409502 1/6 (17%)
IG_like 328..399 CDD:214653 18/77 (23%)
Ig strand B 333..337 CDD:409504 0/3 (0%)
Ig strand C 347..351 CDD:409504 2/10 (20%)
Ig strand E 365..369 CDD:409504 1/3 (33%)
Ig strand F 379..384 CDD:409504 2/4 (50%)
4.1m 437..452 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.