DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and Nphs1

DIOPT Version :10

Sequence 1:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_062332.2 Gene:Nphs1 / 54631 MGIID:1859637 Length:1256 Species:Mus musculus


Alignment Length:992 Identity:201/992 - (20%)
Similarity:316/992 - (31%) Gaps:362/992 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DSHVKTKDIDAVEGKSVSLPC-------PIT-------EPLDNVYMVLWFRDNAGIPLYS---FD 96
            :.||:.       |:::.|||       |.|       :|:.    :.|..::|....:|   ..
Mouse   266 EGHVRA-------GENLELPCIARGGNPPATLQWLKNGKPVS----IAWGTEHAQAVAHSVLVMT 319

  Fly    97 VRDKESREQPRHWSAPEVFGSRAKFH-FDSQPATLEIKDIKRHDQGIYRCRVDF---------RT 151
            ||             ||..|:|.... ::|..|..:.:.|        ..:|.|         .|
Mouse   320 VR-------------PEDHGARLSCQSYNSVSAETQERSI--------TLQVTFPPSAVTILGST 363

  Fly   152 SQTQSFRFNLSVIILPEQPIIMDRW---GRQL-----------------------------NGTQ 184
            ||:::....|..:....:|.::.||   ||||                             ||..
Mouse   364 SQSENKNVTLCCLTKSSRPRVLLRWWLGGRQLLPTDETVMDGLHGGHISMSNLTLLVKREDNGLS 428

  Fly   185 L--------------------------------GPKQ-----EGDDIVITCRVVGGRPQPQVRWL 212
            |                                ||.:     .|..:.:.|..:||.|:|.:.||
Mouse   429 LTCEAFSDAFSKETFKKSLTLNVKYPAQKLWIEGPPEGQSIRTGTRVRLVCLAIGGNPEPSLTWL 493

  Fly   213 VNGLLVDNQNE------------HNSGDVIENRLLWPSVQRNDLNSVFTCQALNTQLDKPKEKSF 265
            .:...|::..:            ..||......|:. .:...|..:.|:|:|  .||....:   
Mouse   494 KDSRPVNDPRQSQEPRRVQLGSVEKSGSTFSRELVL-IIGPPDNLAKFSCKA--GQLSASTQ--- 552

  Fly   266 ILDMHLKPLVVKILEPPSSMIADRRYEVSCESSGSRPNAIITWYKGKRQLRRTKDDIS------- 323
             |.:...|..:.||...|::.......::|.|..|.|...::..|...:|    ||::       
Mouse   553 -LVVQFPPTNLTILANSSALRPGDALNLTCVSISSNPPVNLSLDKEGERL----DDVAAKPQSAP 612

  Fly   324 -KNSTRSELSFVPTTD-DDGKSITCRAENPNVNGLYLETMWKLNVVYPPLVTLRLGSTLTPDDIK 386
             |.|..|...|:..:. |.|..:||||.:..:... :.:.::|||:|||..   ||..:....:.
Mouse   613 FKGSAASRSVFLRVSSRDHGHRVTCRAHSEALRET-VSSFYRLNVLYPPEF---LGEQVRAVTVV 673

  Fly   387 EGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSAR-VIRSNQSLVLQKITKHYAGNYACSAIND 450
            |.........|.:||......|...|..|......| .|.|..:|.|..:|:...|.|.....|.
Mouse   674 EQGQALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGFYQLHCQNS 738

  Fly   451 EGETVSNQLPLRVKYTPMCKHADRVILIGASKDET-------VEVVCEIQADP-PPRTFRW---- 503
            || |....|.|.|.|.|         .|.|.||.|       |::||.:.|:| .|..|.|    
Mouse   739 EG-TAEALLKLDVHYAP---------TIRALKDPTEVNVGGSVDIVCTVDANPILPEMFSWERLG 793

  Fly   504 ----KFN-------NSGET--LDVGSERFSVNGS-----------------RSILKYTPVTD--- 535
                :.|       :.|.|  |.:...:.|..|:                 |.::::.|..|   
Mouse   794 EDEEELNLDDMEKMSKGSTGRLRIRQAKLSQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDHPT 858

  Fly   536 ----------------------------------------------------------------- 535
                                                                             
Mouse   859 PLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDLQDPRYTEHKYHQGVVHSSLLTIANV 923

  Fly   536 ---QDYGTLSCWASNEVGTQQHPCLFQVVLAALPNAVSNCTVFNRTELSVDIQCIPGYDGGLPQI 597
               |||....|.|:|.:|: .|..: |:|..:.|:......|.:.:..||.::..||:||||||.
Mouse   924 SAAQDYALFKCTATNALGS-DHTNI-QLVSISRPDPPLGLKVVSVSPHSVGLEWKPGFDGGLPQR 986

  Fly   598 FVLEMFSTRT-GITRFNLSNAEEALFSLENLDTLTSMMVQENNSLRLRIY--SYNQKGRSAAYLL 659
            |.:...:..: |....::..|:...|:|..|          ..|.|.||:  :.|..|.|.   |
Mouse   987 FQIRYEALESPGFLYMDVLPAQATTFTLTGL----------KPSTRYRIWLLASNALGDSG---L 1038

  Fly   660 TDFII-------GSTAYKTDDD-----------VTLTLSPVI--VGSVLTIIIIGVAIAIRIFVV 704
            ||..|       |......|.|           ..|.|.||:  ||.:|.:     :.|..:..:
Mouse  1039 TDKGIQVSITTPGLDQAPEDTDQPLPTEQPPGPPRLPLLPVLFAVGGLLLL-----SNASCVGGL 1098

  Fly   705 TFVHNLRRNRHHGSKATAAGVTAQPSDVFKGGNLEKPRWQHTDIKTKSSEDLVEDERDPDVIPSQ 769
            .:...|||.....|:.|.||                           |.||.:.:|.:    .||
Mouse  1099 LWRRRLRRLAEEISEKTEAG---------------------------SEEDRIRNEYE----ESQ 1132

  Fly   770 YVGGSSAGSSGSNASNV 786
            :.|.....||..:.:.|
Mouse  1133 WTGDRDTRSSTVSTAEV 1149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001400995.1 V-set 55..163 CDD:462230 25/134 (19%)
Ig_3 190..254 CDD:464046 16/75 (21%)
Ig <292..366 CDD:472250 19/82 (23%)
Ig strand B 292..295 CDD:409418 0/2 (0%)
Ig strand C 305..309 CDD:409418 0/3 (0%)
Ig strand E 329..333 CDD:409418 1/3 (33%)
Ig strand F 343..348 CDD:409418 2/4 (50%)
Ig strand G 359..362 CDD:409418 0/2 (0%)
Ig 382..457 CDD:472250 19/75 (25%)
Ig strand B 391..395 CDD:409405 0/3 (0%)
Ig strand C 405..409 CDD:409405 0/3 (0%)
Ig strand E 428..432 CDD:409405 1/3 (33%)
Ig strand F 442..447 CDD:409405 1/4 (25%)
Ig 486..554 CDD:409353 24/173 (14%)
Ig strand B 486..490 CDD:409353 1/3 (33%)
Ig strand C 500..504 CDD:409353 2/11 (18%)
Ig strand E 526..530 CDD:409353 0/3 (0%)
Ig strand F 540..545 CDD:409353 1/4 (25%)
Nphs1NP_062332.2 IG_like 52..127 CDD:214653
Ig strand B 63..67 CDD:409353
Ig strand C 75..79 CDD:409353
Ig strand E 106..112 CDD:409353
Ig strand F 122..127 CDD:409353
Ig strand G 131..134 CDD:409353
C2-set_2 155..242 CDD:400489
Ig strand B 170..174 CDD:409353
Ig strand C 184..188 CDD:409353
Ig strand E 214..218 CDD:409353
Ig strand F 228..233 CDD:409353
Ig strand G 243..246 CDD:409353
Ig 251..344 CDD:472250 20/101 (20%)
Ig strand B 275..279 CDD:409353 1/3 (33%)
Ig strand C 289..293 CDD:409353 1/3 (33%)
Ig strand E 314..318 CDD:409353 1/3 (33%)
Ig strand F 328..332 CDD:409353 1/3 (33%)
Ig strand G 340..343 CDD:409353 0/2 (0%)
C2-set_2 358..442 CDD:400489 14/83 (17%)
Ig strand B 371..375 CDD:409353 1/3 (33%)
Ig strand C 385..389 CDD:409353 1/3 (33%)
Ig strand E 414..418 CDD:409353 0/3 (0%)
Ig strand F 428..433 CDD:409353 1/4 (25%)
Ig 472..555 CDD:472250 19/89 (21%)
Ig strand B 475..479 CDD:409353 0/3 (0%)
Ig strand C 489..493 CDD:409353 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..516 3/24 (13%)
Ig strand E 513..529 CDD:409353 3/15 (20%)
Ig strand G 548..551 CDD:409353 0/2 (0%)
Ig 563..646 CDD:472250 21/86 (24%)
Ig strand B 577..581 CDD:409353 0/3 (0%)
Ig strand C 591..595 CDD:409353 0/3 (0%)
Ig strand E 620..624 CDD:409353 0/3 (0%)
Ig strand F 634..639 CDD:409353 2/4 (50%)
Ig strand G 649..652 CDD:409353 0/2 (0%)
Ig 660..750 CDD:472250 24/93 (26%)
Ig strand B 678..682 CDD:409353 0/3 (0%)
Ig strand C 692..696 CDD:409353 0/3 (0%)
Ig strand E 716..720 CDD:409353 1/3 (33%)
Ig strand F 730..735 CDD:409353 1/4 (25%)
Ig strand G 743..746 CDD:409353 0/2 (0%)
Ig_3 754..834 CDD:464046 20/88 (23%)
Ig 848..956 CDD:472250 12/109 (11%)
Ig strand B 873..877 CDD:143250 0/3 (0%)
Ig strand C 886..890 CDD:143250 0/3 (0%)
Ig strand E 916..920 CDD:143250 0/3 (0%)
Ig strand F 931..936 CDD:143250 1/4 (25%)
Ig strand G 953..956 CDD:143250 0/2 (0%)
FN3 955..1049 CDD:238020 29/106 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1048..1071 3/22 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1112..1143 12/61 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.