DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and CNTN5

DIOPT Version :10

Sequence 1:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_055176.1 Gene:CNTN5 / 53942 HGNCID:2175 Length:1100 Species:Homo sapiens


Alignment Length:992 Identity:193/992 - (19%)
Similarity:312/992 - (31%) Gaps:331/992 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IDAVEGKSVSLPC-PITEPLDNVYMVLWFRDNAGIPLYSFDVRDKESREQPRHWSAPEVFGSRAK 120
            :.|.:|.:|.:.| .:..|   |..:.|.:.|..||                         |:|:
Human   310 VTAAKGTTVKMECFALGNP---VPTITWMKVNGYIP-------------------------SKAR 346

  Fly   121 FHFDSQPATLEIKDIKRHDQGIYRCRVDFRTSQTQSFRFNLSVIILPEQPIIMDRWGRQLNGTQL 185
            ..  ...|.|||.:::..|.|||.||.: .:....|||..|.|...|       .|..:||.|||
Human   347 LR--KSQAVLEIPNVQLDDAGIYECRAE-NSRGKNSFRGQLQVYTYP-------HWVEKLNDTQL 401

  Fly   186 GPKQEGDDIVITCRVVGGRPQPQVRWLVNG---------------LLVDNQNEHNSGDVIENRLL 235
               ..|..:...|:.. |:|:|..|||.||               |::.|.|:.::|       :
Human   402 ---DSGSPLRWECKAT-GKPRPTYRWLKNGVPLSPQSRVEMVNGVLMIHNVNQSDAG-------M 455

  Fly   236 WPSVQRNDLNSVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADRRYEVSCESSGS 300
            :..:..|...:::....|......|   :|.|:...|.::|         ..|:...:.|:..||
Human   456 YQCLAENKYGAIYASAELKILASAP---TFALNQLKKTIIV---------TKDQEVVIECKPQGS 508

  Fly   301 RPNAIITWYKGKRQLRRTKDDISKNSTRSELSFVP---------TTDDDGKSITCRAENPNVNGL 356
             |...|:|.||.|.:|..|          .::.:|         :..|:||.: ||.|  ||.| 
Human   509 -PKPTISWKKGDRAVRENK----------RIAILPDGSLRILNASKSDEGKYV-CRGE--NVFG- 558

  Fly   357 YLETMWKLNVVYPPLVTLRLGSTLTP--DDIKEGDDVYFECHVQSNPQWR-KLLWLHNGIHLE-- 416
            ..|.:..|:|..|..:      .|||  .::..|:.:...|....:.... ...|...|..::  
Human   559 SAEIIASLSVKEPTRI------ELTPKRTELTVGESIVLNCKAIHDASLDVTFYWTLKGQPIDFE 617

  Fly   417 ----HNTSARVIRSNQSLVLQKITKHYAGNYACSAINDEGETVSNQLPLRVKYTPMCKHADRVIL 477
                |..|.|...|:..|:::.|...:||.|.| .:....::||::..|.|:..|   ....:::
Human   618 EEGGHFESIRAQASSADLMIRNILLMHAGRYGC-RVQTTADSVSDEAELLVRGPP---GPPGIVI 678

  Fly   478 IGASKDETVEVVCEIQAD--PPPRTF----RWKFNNSGETLDVGSERFSVNG---SRSILKYTPV 533
            :....:.|..:.....||  .|..::    |..|:...:|:....|  .:.|   |...:...|.
Human   679 VEEITESTATLSWSPAADNHSPISSYNLQARSPFSLGWQTVKTVPE--IITGDMESAMAVDLNPW 741

  Fly   534 TDQDYGTLSCWASNEVGTQQHPCLFQVVLAALPNAVSNCTVFNRTELSVDIQCIPGYDGGLPQIF 598
            .:.::..:   |:|.:||..            |:..|.....|..........:.|..|...::.
Human   742 VEYEFRVV---ATNPIGTGD------------PSTPSRMIRTNEAVPKTAPTNVSGRSGRRHELV 791

  Fly   599 -----VLEMFSTRTGI----------TR------FNLSNAEEALFSLENLDTLTSMMVQENNSLR 642
                 |.|.|....|.          ||      ...|.|.:.::..|::..||...|       
Human   792 IAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKFIYRDESVPPLTPFEV------- 849

  Fly   643 LRIYSYNQKGRSAAYLLTDFIIGSTAYKTDDDVTLTLSPVIVGSVLTIIIIGVAIAIRIFVVTFV 707
             ::..||.||.                               |....|::|              
Human   850 -KVGVYNNKGD-------------------------------GPFSQIVVI-------------- 868

  Fly   708 HNLRRNRHHGSKATAAGVTAQPSDVFKGGNLEKPRWQHTDIKTKS---SEDLV------EDERDP 763
                        .:|.|               :|....||:|..|   ||.||      |....|
Human   869 ------------CSAEG---------------EPSAAPTDVKATSVSVSEILVAWKHIKESLGRP 906

  Fly   764 DVIPSQYVGGSSAGSSGSNASNVGSTTAGTATGSSTSTAVVANANAAASAMAGPGGATSSASAT- 827
            ......|........:.......|:.:....||...:|  :.:....|...||.|..:|..||| 
Human   907 QGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNT--LYHFTVRAYNGAGYGPPSSEVSATT 969

  Fly   828 ----------------DGHQFASGTAAAGGGASKWSPNGNVTTTMLTGDAVNATVTYNQ------ 870
                            .|.|.:.|          |.|   |.......:.|...|.|.|      
Human   970 KKSPPSQAPSNLRWEQQGSQVSLG----------WEP---VIPLANESEVVGYKVFYRQEGHSNS 1021

  Fly   871 --INAQRAQLLAAVAAVG--------------GGCSSTVISPSSSILGGLGKPLGMGMGMGLGMG 919
              |..|:.|.:..:...|              |..||.:..||.|                    
Human  1022 QVIETQKLQAVVPLPDAGVYIIEVRAYSEGGDGTASSQIRVPSYS-------------------- 1066

  Fly   920 VGGTVIGSPTSLSSTAT 936
             ||.:..:.::|.|.:|
Human  1067 -GGKITSAQSTLHSLST 1082

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001400995.1 V-set 55..163 CDD:462230 26/106 (25%)
Ig_3 190..254 CDD:464046 15/78 (19%)
Ig <292..366 CDD:472250 23/82 (28%)
Ig strand B 292..295 CDD:409418 0/2 (0%)
Ig strand C 305..309 CDD:409418 1/3 (33%)
Ig strand E 329..333 CDD:409418 0/3 (0%)
Ig strand F 343..348 CDD:409418 1/4 (25%)
Ig strand G 359..362 CDD:409418 1/2 (50%)
Ig 382..457 CDD:472250 16/83 (19%)
Ig strand B 391..395 CDD:409405 0/3 (0%)
Ig strand C 405..409 CDD:409405 0/3 (0%)
Ig strand E 428..432 CDD:409405 1/3 (33%)
Ig strand F 442..447 CDD:409405 2/4 (50%)
Ig 486..554 CDD:409353 14/76 (18%)
Ig strand B 486..490 CDD:409353 0/3 (0%)
Ig strand C 500..504 CDD:409353 1/7 (14%)
Ig strand E 526..530 CDD:409353 0/3 (0%)
Ig strand F 540..545 CDD:409353 0/4 (0%)
CNTN5NP_055176.1 IgI_1_Contactin-5 98..193 CDD:409435
Ig strand A 100..104 CDD:409435
Ig strand A' 107..112 CDD:409435
Ig strand B 118..126 CDD:409435
Ig strand C 131..137 CDD:409435
Ig strand C' 139..142 CDD:409435
Ig strand D 149..153 CDD:409435
Ig strand E 155..161 CDD:409435
Ig strand F 168..177 CDD:409435
Ig strand G 180..193 CDD:409435
Ig 202..287 CDD:472250
Ig strand B 213..217 CDD:409392
Ig strand C 227..231 CDD:409392
Ig strand E 252..256 CDD:409392
Ig strand F 266..271 CDD:409392
Ig strand G 282..285 CDD:409392
Ig 300..387 CDD:472250 26/107 (24%)
Ig strand B 318..322 CDD:409357 1/3 (33%)
Ig strand C 331..335 CDD:409357 0/3 (0%)
Ig strand E 352..356 CDD:409357 2/3 (67%)
Ig strand F 366..371 CDD:409357 3/4 (75%)
Ig strand G 379..382 CDD:409357 2/2 (100%)
Ig 392..475 CDD:472250 22/93 (24%)
Ig strand B 407..411 CDD:409353 0/3 (0%)
Ig strand C 420..424 CDD:409353 1/3 (33%)
Ig strand E 441..445 CDD:409353 1/3 (33%)
Ig strand F 455..460 CDD:409353 0/4 (0%)
Ig strand G 468..471 CDD:409353 0/2 (0%)
Ig5_Contactin 480..568 CDD:409358 29/114 (25%)
Ig strand A 480..485 CDD:409358 2/7 (29%)
Ig strand A' 488..493 CDD:409358 1/4 (25%)
Ig strand B 497..504 CDD:409358 0/6 (0%)
Ig strand C 512..516 CDD:409358 1/3 (33%)
Ig strand D 530..533 CDD:409358 0/2 (0%)
Ig strand E 534..539 CDD:409358 0/4 (0%)
Ig strand F 547..555 CDD:409358 5/10 (50%)
Ig strand G 561..568 CDD:409358 2/6 (33%)
Ig 570..671 CDD:472250 22/107 (21%)
Ig strand B 589..593 CDD:409359 0/3 (0%)
Ig strand C 604..608 CDD:409359 0/3 (0%)
Ig strand E 633..637 CDD:409359 1/3 (33%)
Ig strand F 647..652 CDD:409359 2/5 (40%)
Ig strand G 660..663 CDD:409359 1/2 (50%)
FN3 671..768 CDD:238020 18/116 (16%)
FN3 <718..>1023 CDD:442628 69/416 (17%)
FN3 878..969 CDD:238020 22/92 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 959..982 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.